You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
F2RL1
Proteinase-activated receptor 2

Protein Summary
Description
Receptor for trypsin and trypsin-like enzymes coupled to G proteins (PubMed:28445455). Its function is mediated through the activation of several signaling pathways including phospholipase C (PLC), intracellular calcium, mitogen-activated protein kinase (MAPK), I-kappaB kinase/NF-kappaB and Rho (PubMed:28445455). Can also be transactivated by cleaved F2R/PAR1. Involved in modulation of inflammatory responses and regulation of innate and adaptive immunity, and acts as a sensor for proteolytic enzymes generated during infection. Generally is promoting inflammation. Can signal synergistically with TLR4 and probably TLR2 in inflammatory responses and modulates TLR3 signaling. Has a protective role in establishing the endothelial barrier; the activity involves coagulation factor X. Regulates endothelial cell barrier integrity during neutrophil extravasation, probably following proteolytic cleavage by PRTN3 (PubMed:23202369). Proposed to have a bronchoprotective role in airway epithelium, bu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296677
  • ENSP00000296677
  • ENSG00000164251

Symbol
  • GPR11
  • PAR2
  • PAR2
  • GPR11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
0.99
PubMedID
0.95
gene perturbation
0.93
transcription factor perturbation
0.88


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 262.24   (req: < 5)
Gene RIFs: 296   (req: <= 3)
Antibodies: 301   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 262.24   (req: >= 5)
Gene RIFs: 296   (req: > 3)
Antibodies: 301   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 58
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 18
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (q) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (q) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Gene Ontology Terms (63)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (206)
1 – 10 of 206
SLMAP
Tbio
Novelty: 0.04279507
p_int: 0.999269008
p_ni: 0.000730992
Score: 0.234
Data Source: BioPlex,STRINGDB
HSDL2
Tbio
Family: Enzyme
Novelty: 0.11659193
p_int: 0.882216098
p_ni: 0.117783902
Score: 0.282
Data Source: BioPlex,STRINGDB
INTS12
Tbio
Family: Epigenetic
Novelty: 0.13805881
p_int: 0.881680222
p_ni: 0.118319766
p_wrong: 1.2e-8
Score: 0.201
Data Source: BioPlex,STRINGDB
C19orf25
Tdark
p_int: 0.752299332
p_ni: 0.247664541
p_wrong: 0.000036127
Score: 0.237
Data Source: BioPlex,STRINGDB
F2
Tclin
Family: Enzyme
Novelty: 0.00006072
Score: 0.959
Data Source: Reactome,STRINGDB
TAC1
Tbio
Novelty: 0.00007711
Score: 0.948
Data Source: STRINGDB
NPS
Tbio
Novelty: 0.00011983
Score: 0.935
Data Source: STRINGDB
KNG1
Tchem
Novelty: 0.00008572
Score: 0.926
Data Source: STRINGDB
PTGER1
Tclin
Family: GPCR
Novelty: 0.00206493
Score: 0.926
Data Source: STRINGDB
GNA14
Tbio
Novelty: 0.12434273
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  262.24

PubMed score by year
PubTator Score  642.38

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLT
1-70
GKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNN
70-140
WIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLY
140-210
VVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEK
210-280
KRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHD
280-350
FRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
350-397
MRSPSAAWLLGAAILLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALADLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMFNYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY