You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IL15
Interleukin-15

Protein Summary
Description
Cytokine that stimulates the proliferation of T-lymphocytes. Stimulation by IL-15 requires interaction of IL-15 with components of IL-2R, including IL-2R beta and probably IL-2R gamma but not IL-2R alpha. The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296545
  • ENSP00000296545
  • ENSG00000164136
  • ENST00000320650
  • ENSP00000323505
  • ENST00000394159
  • ENSP00000377714
  • ENST00000477265
  • ENSP00000436914
  • ENST00000514653
  • ENSP00000422271
  • ENST00000529613
  • ENSP00000435462

Symbol
  • IL-15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
PubMedID
0.86
transcription factor perturbation
0.84
histone modification site profile
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1381.15   (req: < 5)
Gene RIFs: 346   (req: <= 3)
Antibodies: 1013   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1381.15   (req: >= 5)
Gene RIFs: 346   (req: > 3)
Antibodies: 1013   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 31
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-15 signaling
Reactome
Interleukin-2 family signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-15 signaling
Interleukin-2 family signaling
Signaling by Interleukins
Gene Ontology Terms (40)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (375)
1 – 10 of 375
GAPDHS
Tbio
Family: Enzyme
Novelty: 0.01313187
p_int: 0.993917198
p_ni: 0.005535827
p_wrong: 0.000546975
Data Source: BioPlex
COL14A1
Tbio
Novelty: 0.00758642
p_int: 0.959076426
p_ni: 0.040923346
p_wrong: 2.28e-7
Data Source: BioPlex
LRIG1
Tbio
Novelty: 0.01148093
p_int: 0.83812439
p_ni: 0.16187561
Data Source: BioPlex
PLXNA3
Tbio
Novelty: 0.01306168
p_int: 0.775124923
p_ni: 0.224875077
Data Source: BioPlex
ITGA7
Tbio
Novelty: 0.01962657
p_int: 0.768523426
p_ni: 0.230504958
p_wrong: 0.000971615
Data Source: BioPlex
ERO1B
Tbio
Novelty: 0.10192488
p_int: 0.767124221
p_ni: 0.071652037
p_wrong: 0.161223742
Data Source: BioPlex
IL2RB
Tclin
Novelty: 0.00753505
Score: 0.998
Data Source: Reactome,STRINGDB
IL15RA
Tbio
Novelty: 0.05309461
Score: 0.997
Data Source: Reactome,STRINGDB
IL2RG
Tclin
Novelty: 0.00155443
Score: 0.996
Data Source: Reactome,STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.982
Data Source: STRINGDB
Publication Statistics
PubMed Score  1381.15

PubMed score by year
PubTator Score  1149.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHID
1-70
ATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELE
70-140
EKNIKEFLQSFVHIVQMFINTS
140-162
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS