You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MFSD8
Major facilitator superfamily domain-containing protein 8

Protein Summary
Description
May be a carrier that transport small solutes by using chemiosmotic ion gradients. This gene encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL). [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296468
  • ENSP00000296468
  • ENSG00000164073
  • ENST00000641434
  • ENSP00000493279
  • ENST00000641464
  • ENSP00000493438
  • ENST00000641686
  • ENSP00000493218
  • ENST00000641748
  • ENSP00000493330
  • ENST00000641928
  • ENSP00000493418

Symbol
  • CLN7
  • CCMD
  • CLN7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.81
histone modification site profile
0.72
tissue sample
0.65
virus perturbation
0.59
transcription factor binding site profile
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 73.22   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 56   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 73.22   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 56   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (78)
1 – 10 of 78
EPHX1
Tchem
Family: Enzyme
Novelty: 0.00210581
p_int: 0.999997318
p_ni: 0.000002682
Data Source: BioPlex
ASGR2
Tbio
Novelty: 0.35502959
p_int: 0.99938016
p_ni: 0.00060202
p_wrong: 0.00001782
Data Source: BioPlex
TPRA1
Tdark
Family: GPCR
Novelty: 0.39628306
p_int: 0.999212637
p_ni: 0.000774681
p_wrong: 0.000012682
Data Source: BioPlex
P2RY12
Tclin
Family: GPCR
Novelty: 0.00057146
p_int: 0.997505031
p_ni: 0.002494966
p_wrong: 4e-9
Data Source: BioPlex
FAM241A
Tdark
Novelty: 2.7184466
p_int: 0.996081503
p_ni: 0.003918395
p_wrong: 1.03e-7
Data Source: BioPlex
CYB5R1
Tbio
Family: Enzyme
Novelty: 0.1277868
p_int: 0.995678851
p_ni: 0.004321149
Data Source: BioPlex
LPAR1
Tchem
Family: GPCR
Novelty: 0.004102
p_int: 0.994621084
p_ni: 0.005376095
p_wrong: 0.000002821
Data Source: BioPlex
FPR2
Tchem
Family: GPCR
Novelty: 0.00286277
p_int: 0.994218651
p_ni: 0.005781099
p_wrong: 2.5e-7
Data Source: BioPlex
KLRC4
Tbio
Novelty: 0.25869807
p_int: 0.994208203
p_ni: 0.005764337
p_wrong: 0.000027461
Data Source: BioPlex
HLA-DQA1
Tbio
Novelty: 0.00059149
p_int: 0.994082648
p_ni: 0.005917248
p_wrong: 1.04e-7
Score: 0.158
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  73.22

PubMed score by year
PubTator Score  23.66

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPT
1-70
ADTSFLGWVIASYSLGQMVASPIFGLWSNYRPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARG
70-140
LLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMY
140-210
TTPVLLSAFLGILNIILILAILREHRVDDSGRQCKSINFEEASTDEAQVPQGNIDQVAVVAINVLFFVTL
210-280
FIFALFETIITPLTMDMYAWTQEQAVLYNGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVG
280-350
FFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFL
350-420
TSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWGPRWAFSLVCG
420-490
IIVLTITLLGVVYKRLIALSVRYGRIQE
490-518
MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWRSIRILYLTMFLSSVGFSVVMMSIWPYLQKIDPTADTSFLGWVIASYSLGQMVASPIFGLWSNYRPRKEPLIVSILISVAANCLYAYLHIPASHNKYYMLVARGLLGIGAGNVAVVRSYTAGATSLQERTSSMANISMCQALGFILGPVFQTCFTFLGEKGVTWDVIKLQINMYTTPVLLSAFLGILNIILILAILREHRVDDSGRQCKSINFEEASTDEAQVPQGNIDQVAVVAINVLFFVTLFIFALFETIITPLTMDMYAWTQEQAVLYNGIILAALGVEAVVIFLGVKLLSKKIGERAILLGGLIVVWVGFFILLPWGNQFPKIQWEDLHNNSIPNTTFGEIIIGLWKSPMEDDNERPTGCSIEQAWCLYTPVIHLAQFLTSAVLIGLGYPVCNLMSYTLYSKILGPKPQGVYMGWLTASGSGARILGPMFISQVYAHWGPRWAFSLVCGIIVLTITLLGVVYKRLIALSVRYGRIQE