You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HPS3
Hermansky-Pudlak syndrome 3 protein

Protein Summary
Description
Involved in early stages of melanosome biogenesis and maturation. This gene encodes a protein containing a potential clathrin-binding motif, consensus dileucine signals, and tyrosine-based sorting signals for targeting to vesicles of lysosomal lineage. The encoded protein may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 3. [provided by RefSeq, Apr 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000296051
  • ENSP00000296051
  • ENSG00000163755

Symbol
  • SUTAL
  • BLOC2S1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
transcription factor binding site profile
0.75
tissue sample
0.66
PubMedID
0.64
transcription factor
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.89   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 160   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.89   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 160   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
FlyBase
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (145)
1 – 10 of 145
HPS6
Tbio
Novelty: 0.07464478
p_int: 0.999904783
p_ni: 0.000095217
Score: 0.991
Data Source: BioPlex,STRINGDB
HPS5
Tbio
Novelty: 0.06540867
p_int: 0.999875602
p_ni: 0.000124398
Score: 0.987
Data Source: BioPlex,STRINGDB
TCL1B
Tbio
Novelty: 0.00845828
p_int: 0.983313652
p_ni: 0.016686348
Score: 0.187
Data Source: BioPlex,STRINGDB
SIRT6
Tchem
Family: Epigenetic
Novelty: 0.00185315
p_int: 0.912724171
p_ni: 0.087275829
Score: 0.316
Data Source: BioPlex,STRINGDB
HPS4
Tbio
Novelty: 0.03587546
Score: 0.975
Data Source: STRINGDB
HPS1
Tbio
Novelty: 0.48
Score: 0.953
Data Source: STRINGDB
DTNBP1
Tbio
Novelty: 0.00371788
Score: 0.941
Data Source: STRINGDB
BLOC1S3
Tbio
Novelty: 0.11822443
Score: 0.936
Data Source: STRINGDB
BLOC1S6
Tbio
Novelty: 0.00418729
Score: 0.933
Data Source: STRINGDB
BLOC1S2
Tbio
Novelty: 0.02730967
Score: 0.898
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.89

PubMed score by year
PubTator Score  15.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVQLYNLHPFGSQQVVPCKLEPDRFCGGGRDALFVAAGCKVEAFAVAGQELCQPRCAFSTLGRVLRLAYS
1-70
EAGDYLVAIEEKNKATFLRAYVNWRNKRTENSRVCIRMIGHNVEGPFSKAFRDQMYIIEMPLSEAPLCIS
70-140
CCPVKGDLLVGCTNKLVLFSLKYQIINEEFSLLDFERSLIIHIDNITPVEVSFCVGYVAVMSDLEVLIVK
140-210
LESGPKNGERVHHHPHKTNNRIRRTEEGISNEISQLESDDFVICQKPLELLGEKSEQSGLSVTLESTGLA
210-280
DEKRKYSHFQHLLYRRFAPDISSYVLSDDIKLHSLQLLPIYQTGSLTSDGKNLSQEKELLSLFCFFSLPH
280-350
VGYLYMVVKSVELMSVYQYPEKSQQAVLTPQFLHVITSNNLQCFTVRCSAAAAREEDPYMDTTLKACPPV
350-420
SMDVCALRIQLFIGLKAICHFKNHIILLTKAEPEAIPERRQSPKRLLSRKDTSVKIKIPPVAEAGWNLYI
420-490
VNTISPVQLYKEMVDYSNTYKTVKTQSCIHLLSEAHLLVRAALMDASQLEPGEKAELLEAFKESCGHLGD
490-560
CYSRLDSQHSHLTLPYYKMSGLSMAEVLARTDWTVEDGLQKYERGLIFYINHSLYENLDEELNEELAAKV
560-630
VQMFYVAEPKQVPHILCSPSMKNINPLTAMSYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSH
630-700
SEMKLVCGFILEPRLLIQQRKGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKD
700-770
EDTIPQLLVDFWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPW
770-840
VHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDI
840-910
LLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNV
910-980
LPEDGTATFFLPYLLYCSRKKPLT
980-1004
MVQLYNLHPFGSQQVVPCKLEPDRFCGGGRDALFVAAGCKVEAFAVAGQELCQPRCAFSTLGRVLRLAYSEAGDYLVAIEEKNKATFLRAYVNWRNKRTENSRVCIRMIGHNVEGPFSKAFRDQMYIIEMPLSEAPLCISCCPVKGDLLVGCTNKLVLFSLKYQIINEEFSLLDFERSLIIHIDNITPVEVSFCVGYVAVMSDLEVLIVKLESGPKNGERVHHHPHKTNNRIRRTEEGISNEISQLESDDFVICQKPLELLGEKSEQSGLSVTLESTGLADEKRKYSHFQHLLYRRFAPDISSYVLSDDIKLHSLQLLPIYQTGSLTSDGKNLSQEKELLSLFCFFSLPHVGYLYMVVKSVELMSVYQYPEKSQQAVLTPQFLHVITSNNLQCFTVRCSAAAAREEDPYMDTTLKACPPVSMDVCALRIQLFIGLKAICHFKNHIILLTKAEPEAIPERRQSPKRLLSRKDTSVKIKIPPVAEAGWNLYIVNTISPVQLYKEMVDYSNTYKTVKTQSCIHLLSEAHLLVRAALMDASQLEPGEKAELLEAFKESCGHLGDCYSRLDSQHSHLTLPYYKMSGLSMAEVLARTDWTVEDGLQKYERGLIFYINHSLYENLDEELNEELAAKVVQMFYVAEPKQVPHILCSPSMKNINPLTAMSYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSHSEMKLVCGFILEPRLLIQQRKGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKDEDTIPQLLVDFWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPWVHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSSLKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT