You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TRAT1
T-cell receptor-associated transmembrane adapter 1

Protein Summary
Description
Stabilizes the TCR (T-cell antigen receptor)/CD3 complex at the surface of T-cells.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295756
  • ENSP00000295756
  • ENSG00000163519

Symbol
  • TCRIM
  • TRIM
  • TCRIM
  • HSPC062
  • pp29/30
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
pathway
0.95
gene perturbation
0.59
virus perturbation
0.55
biological process
0.54
cell type or tissue
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 439.77   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 243   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 439.77   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 243   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Downstream TCR signaling
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Constitutive Signaling by Aberrant PI3K in Cancer
Disease
Diseases of signal transduction
Downstream TCR signaling
Protein-Protein Interactions (143)
1 – 10 of 143
DACT3
Tbio
Novelty: 0.01168094
p_int: 0.999994706
p_ni: 0.000003851
p_wrong: 0.000001443
Data Source: BioPlex
GOPC
Tbio
Novelty: 0.0164207
p_int: 0.991176139
p_ni: 0.00882386
Data Source: BioPlex
PLXDC2
Tbio
Novelty: 0.11383622
p_int: 0.967112782
p_ni: 0.032887218
Data Source: BioPlex
ACADVL
Tbio
Family: Enzyme
Novelty: 0.00501425
p_int: 0.872171225
p_ni: 0.127286292
p_wrong: 0.000542483
Data Source: BioPlex
FHL2
Tbio
Novelty: 0.0024802
p_int: 0.809319701
p_ni: 0.190680295
p_wrong: 5e-9
Data Source: BioPlex
GRN
Tbio
Novelty: 0.00096763
p_int: 0.791441168
p_ni: 0.208553141
p_wrong: 0.000005691
Data Source: BioPlex
CD247
Tbio
Novelty: 0.00275443
Score: 0.977
Data Source: STRINGDB
CD3E
Tclin
Novelty: 0.00541492
Score: 0.968
Data Source: STRINGDB
CD3D
Tclin
Novelty: 0.00372579
Score: 0.964
Data Source: STRINGDB
ZAP70
Tchem
Family: Kinase
Novelty: 0.00136499
Score: 0.952
Data Source: STRINGDB
Publication Statistics
PubMed Score  439.77

PubMed score by year
PubTator Score  27.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMI
1-70
SEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQL
70-140
HAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
140-186
MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN