You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
STK36
Serine/threonine-protein kinase 36

Protein Summary
Description
Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors (PubMed:10806483). Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization (PubMed:10806483). GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur (PubMed:10806483). Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function (By similarity). Essential for construction of the central pair apparatus of motile cilia. This gene encodes a member of the serine/threonine kinase family of enzymes. This family member is similar to a Drosophila protein that plays a key role in the Hedgehog signaling pathway. This human protein is a positive regulator of the GLI zinc-finger tran ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295709
  • ENSP00000295709
  • ENSG00000163482
  • ENST00000392105
  • ENSP00000375954
  • ENST00000440309
  • ENSP00000394095

Symbol
  • KIAA1278
  • FU
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
protein domain
0.92
histone modification site profile
0.91
cell type or tissue
0.76
small molecule
0.75


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.23   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 166   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.23   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 166   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 12
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (16)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
PathwayCommons: panther
Hedgehog signaling pathway
PathwayCommons: netpath
Hedgehog
PathwayCommons: pid
Hedgehog signaling events mediated by Gli proteins
Name
Explore in Pharos
Explore in Source
Hedgehog signaling pathway
Hedgehog
Hedgehog signaling events mediated by Gli proteins
Protein-Protein Interactions (81)
1 – 10 of 81
ECT2
Tbio
Novelty: 0.01014877
p_int: 0.99992053
p_ni: 4e-9
p_wrong: 0.000079465
Data Source: BioPlex
HSP90AA5P
Tdark
p_int: 0.999860425
p_ni: 0.000139575
Data Source: BioPlex
MUL1
Tbio
Family: Enzyme
Novelty: 0.00348607
p_int: 0.98931773
p_ni: 0.009820483
p_wrong: 0.000861787
Data Source: BioPlex
FCGRT
Tchem
Novelty: 0.0014463
p_int: 0.986675876
p_ni: 0.013298687
p_wrong: 0.000025437
Data Source: BioPlex
CITED1
Tbio
Novelty: 0.02087842
p_int: 0.981522786
p_ni: 0.018477212
p_wrong: 1e-9
Data Source: BioPlex
STARD3
Tbio
Novelty: 0.02326413
p_int: 0.952440075
p_ni: 0.047531365
p_wrong: 0.00002856
Data Source: BioPlex
ARAF
Tchem
Family: Kinase
Novelty: 0.00316774
p_int: 0.934724605
p_ni: 0.065275395
Data Source: BioPlex
RIPK4
Tchem
Family: Kinase
Novelty: 0.00970161
p_int: 0.905958506
p_ni: 0.093301012
p_wrong: 0.000740481
Data Source: BioPlex
ACVR1B
Tchem
Family: Kinase
Novelty: 0.00898287
p_int: 0.826515812
p_ni: 0.173482665
p_wrong: 0.000001523
Score: 0.185
Data Source: BioPlex,STRINGDB
ERBB2
Tclin
Family: Kinase
Novelty: 0.00004664
p_int: 0.796815033
p_ni: 0.203184967
Data Source: BioPlex
Publication Statistics
PubMed Score  2.23

PubMed score by year
PubTator Score  3.03

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRHPNIVHMLDSF
1-70
ETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIK
70-140
LCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYATSIFQLVS
140-210
LILKDPVRWPSTISPCFKNFLQGLLTKDPRQRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPE
210-280
LQVLKDEQAHRLAPKGNQSRILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQE
280-350
SSLLAGILASELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEW
350-420
QHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLSSLLSSCSDSV
420-490
ALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFACTFNLERSQTSDSLQVFQEA
490-560
ANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGNSRAISKAFYSSLLTTQQVVLDGLLHGLTVP
560-630
QLPVHTPQGAPQVSQPLREQSEDIPGAISSALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPS
630-700
LISGLQHPILCLHLLKVLYSCCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLV
700-770
FRLQNLPCGMEKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRL
770-840
TPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEGELSLSSPPSP
840-910
EPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLCPSFLNQLRQAPHGSEFLPVV
910-980
VLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQVCCYHLPLMQVELPISLLTRLALMDPTSLNQ
980-1050
FVNTVSASPRTIVSFLSVALLSDQPLLTSDLLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGH
1050-1120
PENSVRAHTYRLLGHLLQHSMALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPAL
1120-1190
AAAVPSMTQLLGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSL
1190-1260
QQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM
1260-1315
MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRHPNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKNFLQGLLTKDPRQRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILASELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEWQHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLSSLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFACTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGNSRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISSALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYSCCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLVFRLQNLPCGMEKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRLTPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEGELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLCPSFLNQLRQAPHGSEFLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQVCCYHLPLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQPLLTSDLLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSVRAHTYRLLGHLLQHSMALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQLLGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSLQQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM