You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TMCO4
Transmembrane and coiled-coil domain-containing protein 4

IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.08   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 78   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.08   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 78   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (17)
1 – 10 of 17
KPTN
Tbio
Novelty: 0.03538431
p_int: 0.999993681
p_wrong: 0.000006319
Score: 0.332
Data Source: BioPlex,STRINGDB
FAM187B
Tdark
Novelty: 0.90909091
Score: 0.824
Data Source: STRINGDB
AP1S3
Tbio
Novelty: 0.19881657
Score: 0.694
Data Source: STRINGDB
AP1S2
Tbio
Novelty: 0.00173088
Score: 0.687
Data Source: STRINGDB
OPN4
Tbio
Family: GPCR
Novelty: 0.00152001
Score: 0.589
Data Source: STRINGDB
ABLIM1
Tbio
Novelty: 0.07133614
Score: 0.558
Data Source: STRINGDB
AP1S1
Tbio
Novelty: 0.02404649
Score: 0.548
Data Source: STRINGDB
VPS29
Tbio
Novelty: 0.02138387
Score: 0.544
Data Source: STRINGDB
SLC52A2
Tbio
Family: Transporter
Novelty: 0.03453638
Score: 0.494
Data Source: STRINGDB
ADIRF
Tbio
Novelty: 0.00047838
Score: 0.486
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.08

PubMed score by year
PubTator Score  0.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAALCGISLSQLFPEPEHSSFCTEFMAGL
1-70
VQWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCH
70-140
MTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGL
140-210
AAPLVAAGAATIIGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHIT
210-280
IAVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIV
280-350
AALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQE
350-420
KDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDR
420-490
RVENVDLTSVVSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSGETPHQVG
490-560
QTQGPISGDTSKLAMSTDPSQAQVPVGLDQSEGASLPAAASPERPPICSHGMDPNPLGCPDCACKTQGPS
560-630
TGLD
630-634
MAMWNRPCQRLPQQPLVAEPTAEGEPHLPTGRELTEANRFAYAALCGISLSQLFPEPEHSSFCTEFMAGLVQWLELSEAVLPTMTAFASGLGGEGADVFVQILLKDPILKDDPTVITQDLLSFSLKDGHYDARARVLVCHMTSLLQVPLEELDVLEEMFLESLKEIKEEESEMAEASRKKKENRRKWKRYLLIGLATVGGGTVIGVTGGLAAPLVAAGAATIIGSAGAAALGSAAGIAIMTSLFGAAGAGLTGYKMKKRVGAIEEFTFLPLTEGRQLHITIAVTGWLASGKYRTFSAPWAALAHSREQYCLAWEAKYLMELGNALETILSGLANMVAQEALKYTVLSGIVAALTWPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDCQGIIEDVILLGAPVEGEAKHWEPFRKVVSGRIINGYCRGDWLLSFVYRTSSVQLRVAGLQPVLLQDRRVENVDLTSVVSGHLDYAKQMDAILKAVGIRTKPGWDEKGLLLAPGCLPSEEPRQAAAAASSGETPHQVGQTQGPISGDTSKLAMSTDPSQAQVPVGLDQSEGASLPAAASPERPPICSHGMDPNPLGCPDCACKTQGPSTGLD