You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
STAT5B
Signal transducer and activator of transcription 5B

Protein Classes
Protein Summary
Description
Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription. Positively regulates hematopoietic/erythroid differentiation. The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different growth hormones. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. This gene was found to fuse to retinoic acid receptor-alpha (RARA) ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293328
  • ENSP00000293328
  • ENSG00000173757

Symbol
  • STAT5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
protein domain
0.99
hub protein
0.98
interacting protein
0.98
biological term
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1003.9   (req: < 5)
Gene RIFs: 183   (req: <= 3)
Antibodies: 832   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1003.9   (req: >= 5)
Gene RIFs: 183   (req: > 3)
Antibodies: 832   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 61
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 4
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (115)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 30
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Reactome
Downstream signal transduction
Reactome
Erythropoietin activates STAT5
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Downstream signal transduction
Erythropoietin activates STAT5
Gene Ontology Terms (65)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (366)
1 – 10 of 366
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
p_int: 0.999999999
p_wrong: 1e-9
Score: 0.949
Data Source: BioPlex,Reactome,STRINGDB
ADAM32
Tdark
Family: Enzyme
Novelty: 0.57613169
p_int: 0.999224247
p_ni: 0.000775753
Score: 0.187
Data Source: BioPlex,STRINGDB
TRMO
Tbio
Novelty: 0.35294118
p_int: 0.995094101
p_ni: 0.003802384
p_wrong: 0.001103516
Score: 0.416
Data Source: BioPlex,STRINGDB
JAK2
Tclin
Family: Kinase
Novelty: 0.00028252
Score: 0.999
Data Source: Reactome,STRINGDB
JAK3
Tclin
Family: Kinase
Novelty: 0.00219647
Score: 0.997
Data Source: Reactome,STRINGDB
JAK1
Tclin
Family: Kinase
Novelty: 0.00136831
Score: 0.996
Data Source: Reactome,STRINGDB
IL2
Tchem
Novelty: 0.00004362
Score: 0.991
Data Source: STRINGDB
EGFR
Tclin
Family: Kinase
Novelty: 0.0000974
Score: 0.99
Data Source: STRINGDB
PRLR
Tbio
Novelty: 0.00161333
Score: 0.988
Data Source: Reactome,STRINGDB
IL2RA
Tclin
Novelty: 0.0009569
Score: 0.987
Data Source: STRINGDB
Publication Statistics
PubMed Score  1003.90

PubMed score by year
PubTator Score  248.65

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQK
1-70
KAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQK
70-140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVS
140-210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE
210-280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA
280-350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
350-420
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAE
420-490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR
490-560
ENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA
560-630
WKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYV
630-700
KPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVE
700-770
ELLGRPMDSQWIPHAQS
770-787
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS