You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
BAX
Apoptosis regulator BAX

Protein Classes
Protein Summary
Description
Plays a role in the mitochondrial apoptotic process. Under normal conditions, BAX is largely cytosolic via constant retrotranslocation from mitochondria to the cytosol mediated by BCL2L1/Bcl-xL, which avoids accumulation of toxic BAX levels at the mitochondrial outer membrane (MOM) (PubMed:21458670). Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000293288
  • ENSP00000293288
  • ENSG00000087088
  • ENST00000345358
  • ENSP00000263262
  • ENST00000354470
  • ENSP00000346461
  • ENST00000356483
  • ENSP00000348871
  • ENST00000415969
  • ENSP00000389971
  • ENST00000515540
  • ENSP00000426328

Symbol
  • BCL2L4
  • BCL2L4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
chemical
1
disease perturbation
0.99
cellular component
0.92
transcription factor binding site profile
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 325.84   (req: < 5)
Gene RIFs: 746   (req: <= 3)
Antibodies: 1862   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 325.84   (req: >= 5)
Gene RIFs: 746   (req: > 3)
Antibodies: 1862   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 96
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 2
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (23)
1 – 5 of 23
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (117)
Activation, translocation and oligomerization of BAX (R-HSA-114294)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation, translocation and oligomerization of BAX
Reactome
Apoptosis
Reactome
Apoptotic factor-mediated response
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Name
Explore in Pharos
Explore in Source
Activation, translocation and oligomerization of BAX
Apoptosis
Apoptotic factor-mediated response
Gene expression (Transcription)
Generic Transcription Pathway
Gene Ontology Terms (110)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
HGNC
Inferred from Direct Assay (IDA)
HGNC
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
HGNC
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (131)
1 – 10 of 131
BCL2L2
Tchem
Novelty: 0.0074087
p_int: 0.999995545
p_ni: 0.000004455
Score: 0.749
Data Source: BioPlex,STRINGDB
BCL2
Tclin
Novelty: 0.00566111
p_int: 0.999881038
p_ni: 0.000118962
Score: 0.967
Data Source: BioPlex,STRINGDB
MCL1
Tchem
Novelty: 0.0003635
p_int: 0.999471446
p_ni: 0.000528554
Score: 0.996
Data Source: BioPlex,STRINGDB
BCL2L15
Tbio
Novelty: 0.08521863
p_int: 0.999350647
p_ni: 0.000649353
Score: 0.365
Data Source: BioPlex,STRINGDB
C6orf222
Tdark
p_int: 0.997676932
p_ni: 0.002323068
Data Source: BioPlex
BCL2L10
Tchem
Novelty: 0.00507419
p_int: 0.997268349
p_ni: 0.002731651
Score: 0.473
Data Source: BioPlex,STRINGDB
BCL2L1
Tchem
Novelty: 0.00021916
p_int: 0.996556649
p_ni: 0.003443351
Score: 0.998
Data Source: BioPlex,STRINGDB
BCL2L12
Tbio
Novelty: 0.02090982
p_int: 0.995879491
p_ni: 0.004120509
Score: 0.579
Data Source: BioPlex,STRINGDB
BCL2L11
Tbio
Novelty: 0.00061517
Score: 0.995
Data Source: STRINGDB
BID
Tbio
Novelty: 0.01362871
Score: 0.993
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  325.84

PubMed score by year
PubTator Score  6579.14

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
1-70
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT
70-140
LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG
140-192
MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG