You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AIRE
Autoimmune regulator

Protein Summary
Description
Transcription factor playing an essential role to promote self-tolerance in the thymus by regulating the expression of a wide array of self-antigens that have the commonality of being tissue-restricted in their expression pattern in the periphery, called tissue restricted antigens (TRA) (PubMed:26084028). Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Mainly expressed by medullary thymic epithelial cells (mTECs), induces the expression of thousands of tissue-restricted proteins, which are presented on major histocompatibility complex class I (MHC-I) and MHC-II molecules to developing T-c ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000291582
  • ENSP00000291582
  • ENSG00000160224

Symbol
  • APECED
  • APS1
  • APSI
  • PGA1
  • AIRE1
  • APECED
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.99
hub protein
0.95
molecular function
0.9
tissue
0.67
gene perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 969.91   (req: < 5)
Gene RIFs: 141   (req: <= 3)
Antibodies: 590   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 969.91   (req: >= 5)
Gene RIFs: 141   (req: > 3)
Antibodies: 590   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (23)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence Model (ISM)
NTNU_SB
Inferred by Curator (IC)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (123)
1 – 10 of 123
NAA30
Tbio
Family: Enzyme
Novelty: 0.04417488
p_int: 0.999926607
p_ni: 0.000060896
p_wrong: 0.000012497
Data Source: BioPlex
MAD2L1BP
Tbio
Novelty: 0.86956522
p_int: 0.99865544
p_ni: 0.001314273
p_wrong: 0.000030286
Data Source: BioPlex
GDPD3
Tdark
Family: Enzyme
Novelty: 0.25974026
p_int: 0.998240073
p_ni: 0.001046736
p_wrong: 0.00071319
Score: 0.194
Data Source: BioPlex,STRINGDB
CTSH
Tchem
Family: Enzyme
Novelty: 0.00380318
p_int: 0.997741797
p_ni: 0.002255984
p_wrong: 0.000002219
Score: 0.214
Data Source: BioPlex,STRINGDB
FBXW5
Tbio
Novelty: 0.24030104
p_int: 0.993976332
p_ni: 0.005669299
p_wrong: 0.000354369
Data Source: BioPlex
SDR9C7
Tbio
Family: Enzyme
Novelty: 0.02004325
p_int: 0.991349017
p_ni: 0.008650732
p_wrong: 2.52e-7
Score: 0.173
Data Source: BioPlex,STRINGDB
CPA4
Tbio
Family: Enzyme
Novelty: 0.01862158
p_int: 0.989757993
p_ni: 0.010242007
Data Source: BioPlex
ACPP
Tchem
Family: Enzyme
Novelty: 0.00403712
p_int: 0.986807517
p_ni: 0.013192482
p_wrong: 1e-9
Data Source: BioPlex
PTPRD
Tbio
Family: Enzyme
Novelty: 0.00348082
p_int: 0.938336342
p_ni: 0.051413777
p_wrong: 0.010249882
Data Source: BioPlex
ALOX12B
Tbio
Family: Enzyme
Novelty: 0.03983447
p_int: 0.918632508
p_ni: 0.081367491
Score: 0.183
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  969.91

PubMed score by year
PubTator Score  725.47

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQD
1-70
STAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARA
70-140
AAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGIL
140-210
IQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVP
210-280
APLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQP
280-350
RAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCV
350-420
GPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAP
420-490
SPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS
490-545
MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLKEKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSFPKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARAAAPAALTPRGTASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVPGARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSSGPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLHQKNEDECAVCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQPRAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAPPSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCAAAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPAKDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS