You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RSPH1
Radial spoke head 1 homolog

Protein Summary
Description
May play an important role in male meiosis (By similarity). It is necessary for proper building of the axonemal central pair and radial spokes. This gene encodes a male meiotic metaphase chromosome-associated acidic protein. This gene is expressed in tissues with motile cilia or flagella, including the trachea, lungs, airway brushings, and testes. Mutations in this gene result in primary ciliary dyskinesia-24. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000291536
  • ENSP00000291536
  • ENSG00000160188
  • ENST00000398352
  • ENSP00000381395

Symbol
  • TSA2
  • TSGA2
  • CT79
  • TSA2
  • RSP44
  • TSGA2
  • RSPH10A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.84
transcription factor
0.6
cell type or tissue
0.58
transcription factor binding site profile
0.58
tissue sample
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.84   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 61   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.84   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 61   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (96)
1 – 10 of 96
RSPH6A
Tdark
Novelty: 0.07169275
p_int: 0.999668641
p_ni: 0.000330565
p_wrong: 7.95e-7
Score: 0.599
Data Source: BioPlex,STRINGDB
RSPH3
Tdark
Novelty: 0.06651885
Score: 0.825
Data Source: STRINGDB
RSPH9
Tbio
Novelty: 0.12094399
Score: 0.806
Data Source: STRINGDB
RSPH4A
Tbio
Novelty: 0.16431248
Score: 0.799
Data Source: STRINGDB
LY6E
Tbio
Novelty: 0.0092984
Score: 0.708
Data Source: STRINGDB
CCDC40
Tbio
Novelty: 0.08874937
Score: 0.691
Data Source: STRINGDB
DNAH5
Tbio
Novelty: 0.02916014
Score: 0.685
Data Source: STRINGDB
CCDC114
Tbio
Novelty: 0.21164021
Score: 0.68
Data Source: STRINGDB
DRC1
Tbio
Novelty: 0.50584913
Score: 0.677
Data Source: STRINGDB
CCDC39
Tbio
Novelty: 0.02850725
Score: 0.675
Data Source: STRINGDB
Publication Statistics
PubMed Score  22.84

PubMed score by year
PubTator Score  13.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGE
1-70
YVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGT
70-140
WVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWK
140-210
ATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESRE
210-280
YDQEEFRYDMDEGNINSEEEETRQSDLQD
280-309
MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQD