You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACTC1
Actin, alpha cardiac muscle 1

Protein Summary
Description
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Actins are highly conserved proteins that are involved in various types of cell motility. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to four others. The protein encoded by this gene belongs to the actin family which is comprised of three main groups of actin isoforms, alpha, beta, and gamma. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. Defects in this gene have been associated with idiopathic dilated cardiomyopathy (IDC) and familial hypertrophic cardiomyopathy (FHC). [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000290378
  • ENSP00000290378
  • ENSG00000159251

Symbol
  • ACTC
  • ACTC
  • ASD5
  • CMD1R
  • CMH11
  • LVNC4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein complex
1
interacting protein
0.99
molecular function
0.94
PubMedID
0.86
pathway
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 319.26   (req: < 5)
Gene RIFs: 34   (req: <= 3)
Antibodies: 245   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 319.26   (req: >= 5)
Gene RIFs: 34   (req: > 3)
Antibodies: 245   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (33)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Dilated cardiomyopathy (DCM)
KEGG
Hypertrophic cardiomyopathy (HCM)
KEGG
Cardiac muscle contraction
KEGG
Adrenergic signaling in cardiomyocytes
Name
Explore in Pharos
Explore in Source
Dilated cardiomyopathy (DCM)
Hypertrophic cardiomyopathy (HCM)
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Gene Ontology Terms (31)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Protein-Protein Interactions (275)
1 – 10 of 275
PHACTR2
Tbio
Family: Enzyme
Novelty: 0.35294118
p_int: 0.989554855
p_ni: 0.010445145
Score: 0.887
Data Source: BioPlex,STRINGDB
ACTB
Tbio
Novelty: 0.00027728
p_int: 0.979447364
p_ni: 0.020552636
Score: 0.984
Data Source: BioPlex,STRINGDB
TMOD3
Tbio
Novelty: 0.06428995
p_int: 0.946626307
p_ni: 0.053373693
Score: 0.835
Data Source: BioPlex,STRINGDB
PFN3
Tdark
Novelty: 0.13982839
p_int: 0.945822438
p_ni: 0.054177562
Score: 0.222
Data Source: BioPlex,STRINGDB
NPB
Tdark
Novelty: 0.00254878
p_int: 0.841877761
p_ni: 0.158122239
Score: 0.171
Data Source: BioPlex,STRINGDB
TWF2
Tbio
Novelty: 0.05199307
p_int: 0.816703586
p_ni: 0.183296414
Score: 0.825
Data Source: BioPlex,STRINGDB
COBL
Tbio
Novelty: 0.03002386
p_int: 0.81179602
p_ni: 0.18820398
Score: 0.726
Data Source: BioPlex,STRINGDB
NDUFA4L2
Tclin
Family: Enzyme
Novelty: 0.1147863
p_int: 0.750102572
p_ni: 0.249897428
Score: 0.285
Data Source: BioPlex,STRINGDB
TPM1
Tbio
Novelty: 0.00363188
Score: 0.997
Data Source: STRINGDB
TPM3
Tbio
Novelty: 0.00170262
Score: 0.979
Data Source: STRINGDB
Publication Statistics
PubMed Score  319.26

PubMed score by year
PubTator Score  30.52

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLK
1-70
YPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQA
70-140
VLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREI
140-210
VRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETT
210-280
YNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILAS
280-350
LSTFQQMWISKQEYDEAGPSIVHRKCF
350-377
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF