You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RHOC
Rho-related GTP-binding protein RhoC

Protein Summary
Description
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells. This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided b ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000285735
  • ENSP00000285735
  • ENSG00000155366
  • ENST00000339083
  • ENSP00000345236
  • ENST00000369632
  • ENSP00000358646
  • ENST00000369633
  • ENSP00000358647
  • ENST00000369637
  • ENSP00000358651
  • ENST00000369638
  • ENSP00000358652
  • ENST00000369642
  • ENSP00000358656

Symbol
  • ARH9
  • ARHC
  • H9
  • ARH9
  • ARHC
  • RHOH9
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.88
PubMedID
0.87
transcription factor perturbation
0.84
disease perturbation
0.83
molecular function
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 243.48   (req: < 5)
Gene RIFs: 115   (req: <= 3)
Antibodies: 318   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 243.48   (req: >= 5)
Gene RIFs: 115   (req: > 3)
Antibodies: 318   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (37)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
Developmental Biology
Reactome
G alpha (12/13) signalling events
Reactome
GPCR downstream signalling
Reactome
RHO GTPase Effectors
Name
Explore in Pharos
Explore in Source
Axon guidance
Developmental Biology
G alpha (12/13) signalling events
GPCR downstream signalling
RHO GTPase Effectors
Gene Ontology Terms (32)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (361)
1 – 10 of 361
RHOA
Tbio
Family: Enzyme
Novelty: 0.0002729
p_int: 0.999999999
Score: 0.985
Data Source: BioPlex,STRINGDB
DAAM2
Tbio
Novelty: 0.10909705
p_int: 0.9999977
p_ni: 0.000001824
p_wrong: 4.75e-7
Score: 0.639
Data Source: BioPlex,STRINGDB
ARHGEF11
Tbio
Novelty: 0.02213023
p_int: 0.999983044
p_ni: 0.000016955
p_wrong: 1e-9
Score: 0.996
Data Source: BioPlex,Reactome,STRINGDB
C1orf198
Tdark
Novelty: 2
p_int: 0.99997803
p_ni: 0.000021964
p_wrong: 6e-9
Score: 0.188
Data Source: BioPlex,STRINGDB
DAAM1
Tbio
Novelty: 0.03087963
p_int: 0.999889614
p_ni: 0.000110386
Score: 0.771
Data Source: BioPlex,STRINGDB
RTKN
Tbio
Novelty: 0.03072918
p_int: 0.999882857
p_ni: 0.000022504
p_wrong: 0.000094639
Score: 0.983
Data Source: BioPlex,Reactome,STRINGDB
ARHGEF1
Tbio
Novelty: 0.00098089
p_int: 0.999864902
p_ni: 0.000135098
Score: 0.985
Data Source: BioPlex,STRINGDB
ARHGEF12
Tbio
Novelty: 0.00213883
p_int: 0.99871162
p_ni: 0.00128838
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
DIAPH1
Tbio
Novelty: 0.01645164
p_int: 0.997557845
p_ni: 0.002442154
p_wrong: 1e-9
Score: 0.897
Data Source: BioPlex,STRINGDB
ZMYM4
Tbio
Novelty: 0.11594195
p_int: 0.983936428
p_ni: 0.016063572
Score: 0.165
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  243.48

PubMed score by year
PubTator Score  246.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLR
1-70
PLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVR
70-140
SEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
140-193
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL