You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
APP
Amyloid-beta A4 protein

Protein Summary
Description
Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Interaction between APP molecules on neighboring cells promotes synaptogenesis (PubMed:25122912). Involved in cell mobility and transcription regulation through protein-protein interactions. Can promote transcription activation through binding to APBB1-KAT5 and inhibits Notch signaling through interaction with Numb. Couples to apoptosis-inducing pathways such as those mediated by G(O) and JIP. Inhibits G(o) alpha ATPase activity (By similarity). Acts as a kinesin I membrane receptor, mediating the axonal transport of beta-secretase and presenilin 1. Involved in copper homeostasis/oxidative stress through copper ion reduction. In vitro, copper-metallated APP induces neuronal death directly or is potentiated through Cu(2+)-mediated low-density lipoprotein oxidation. Can regulate neurite outgrowth through binding to components ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000346798
  • ENSP00000284981
  • ENSG00000142192
  • ENST00000348990
  • ENSP00000345463
  • ENST00000354192
  • ENSP00000346129
  • ENST00000357903
  • ENSP00000350578
  • ENST00000358918
  • ENSP00000351796
  • ENST00000440126
  • ENSP00000387483

Symbol
  • A4
  • AD1
  • AAA
  • AD1
  • PN2
  • ABPP
  • APPI
  • CVAP
  • ABETA
  • PN-II
  • preA4
  • CTFgamma
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
disease perturbation
1
hub protein
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10317.98   (req: < 5)
Gene RIFs: 2119   (req: <= 3)
Antibodies: 3786   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10317.98   (req: >= 5)
Gene RIFs: 2119   (req: > 3)
Antibodies: 3786   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 170
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 445
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (135)
1 – 5 of 135
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (72)
Advanced glycosylation endproduct receptor signaling (R-HSA-879415)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 56
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Advanced glycosylation endproduct receptor signaling
Reactome
Amyloid fiber formation
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
Cytokine Signaling in Immune system
Reactome
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Name
Explore in Pharos
Explore in Source
Advanced glycosylation endproduct receptor signaling
Amyloid fiber formation
Class A/1 (Rhodopsin-like receptors)
Cytokine Signaling in Immune system
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Gene Ontology Terms (221)
Items per page:
10
1 – 10 of 27
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
ARUK-UCL
Inferred from Direct Assay (IDA)
ARUK-UCL
Inferred from Direct Assay (IDA)
ARUK-UCL
Inferred from Direct Assay (IDA)
ARUK-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
ARUK-UCL
Inferred from Physical Interaction (IPI)
ARUK-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
ARUK-UCL
Protein-Protein Interactions (1076)
1 – 10 of 1076
CES2
Tchem
Family: Enzyme
Novelty: 0.0023511
p_int: 0.999999959
p_wrong: 4.1e-8
Score: 0.255
Data Source: BioPlex,STRINGDB
FRMD6
Tbio
Novelty: 0.00666729
p_int: 0.999993692
p_ni: 0.000006071
p_wrong: 2.37e-7
Score: 0.211
Data Source: BioPlex,STRINGDB
APBB2
Tbio
Novelty: 0.09429731
p_int: 0.999986814
p_ni: 0.000013186
Score: 0.958
Data Source: BioPlex,STRINGDB
UTP11
Tbio
Novelty: 0.25040827
p_int: 0.999984401
p_ni: 0.000014313
p_wrong: 0.000001286
Data Source: BioPlex
SULF1
Tbio
Family: Enzyme
Novelty: 0.01159942
p_int: 0.999910216
p_ni: 0.000089672
p_wrong: 1.11e-7
Score: 0.185
Data Source: BioPlex,STRINGDB
ZNF107
Tdark
Family: TF
Novelty: 0.13636364
p_int: 0.999763878
p_ni: 0.000236122
Score: 0.165
Data Source: BioPlex,STRINGDB
APBB3
Tdark
Novelty: 0.21392217
p_int: 0.99957742
p_ni: 0.00042258
Score: 0.681
Data Source: BioPlex,STRINGDB
INHBE
Tbio
Novelty: 0.08626833
p_int: 0.999450535
p_ni: 0.000201982
p_wrong: 0.000347482
Score: 0.274
Data Source: BioPlex,STRINGDB
APBB1
Tbio
Novelty: 0.00451241
p_int: 0.999297512
p_ni: 0.000702488
Score: 0.999
Data Source: BioPlex,STRINGDB
ZNF431
Tdark
Family: TF
Novelty: 1.42857143
p_int: 0.999136427
p_ni: 0.000008381
p_wrong: 0.000855191
Data Source: BioPlex
Publication Statistics
PubMed Score  10317.98

PubMed score by year
PubTator Score  10690.91

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGIL
1-70
QYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQER
70-140
MDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWW
140-210
GGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTT
210-280
ESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLL
280-350
KTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
350-420
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHV
420-490
FNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD
490-560
EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVP
560-630
ANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKG
630-700
AIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
700-770
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEEEADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN