You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BMP6
Bone morphogenetic protein 6

Protein Summary
Description
Induces cartilage and bone formation. This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates a wide range of biological processes including iron homeostasis, fat and bone development, and ovulation. Differential expression of this gene may be associated with progression of breast and prostate cancer. Mutations in this gene may be associated with iron overload in human patients. [provided by RefSeq, Jul 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000283147
  • ENSP00000283147
  • ENSG00000153162

Symbol
  • VGR
  • VGR
  • VGR1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
PubMedID
0.96
gene perturbation
0.84
disease
0.77
biological term
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 413.5   (req: < 5)
Gene RIFs: 91   (req: <= 3)
Antibodies: 417   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 413.5   (req: >= 5)
Gene RIFs: 91   (req: > 3)
Antibodies: 417   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 45
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (18)
Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
TGF-beta signaling pathway
KEGG
Hippo signaling pathway
KEGG
Cytokine-cytokine receptor interaction
KEGG
Ovarian steroidogenesis
Name
Explore in Pharos
Explore in Source
TGF-beta signaling pathway
Hippo signaling pathway
Cytokine-cytokine receptor interaction
Ovarian steroidogenesis
Gene Ontology Terms (48)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
MGI
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (111)
1 – 10 of 111
BMPR2
Tchem
Family: Kinase
Novelty: 0.00191079
Score: 0.988
Data Source: STRINGDB
BMPR1A
Tchem
Family: Kinase
Novelty: 0.00472897
Score: 0.986
Data Source: STRINGDB
BMPR1B
Tchem
Family: Kinase
Novelty: 0.00996192
Score: 0.984
Data Source: STRINGDB
SMAD5
Tbio
Family: TF
Novelty: 0.00607935
Score: 0.979
Data Source: STRINGDB
NOG
Tbio
Novelty: 0.00131071
Score: 0.976
Data Source: STRINGDB
SMAD1
Tbio
Family: TF
Novelty: 0.0421653
Score: 0.947
Data Source: STRINGDB
BAMBI
Tbio
Novelty: 0.00637661
Score: 0.943
Data Source: STRINGDB
HJV
Tbio
Novelty: 0.00627463
Score: 0.907
Data Source: STRINGDB
AHSG
Tbio
Novelty: 0.00097441
Score: 0.904
Data Source: STRINGDB
SOST
Tclin
Novelty: 0.00097341
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  413.50

PubMed score by year
PubTator Score  231

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRR
1-70
LKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLY
70-140
NALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLN
140-210
DADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVL
210-280
QEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRD
280-350
GPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS
350-420
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLY
420-490
FDDNSNVILKKYRNMVVRACGCH
490-513
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLPRGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAHPLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKFNLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWASEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH