You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HSPB8
Heat shock protein beta-8

Protein Summary
Description
Displays temperature-dependent chaperone activity. The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The expression of this gene in induced by estrogen in estrogen receptor-positive breast cancer cells, and this protein also functions as a chaperone in association with Bag3, a stimulator of macroautophagy. Thus, this gene appears to be involved in regulation of cell proliferation, apoptosis, and carcinogenesis, and mutations in this gene have been associated with different neuromuscular diseases, including Charcot-Marie-Tooth disease. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000281938
  • ENSP00000281938
  • ENSG00000152137

Symbol
  • CRYAC
  • E2IG1
  • HSP22
  • H11
  • HMN2
  • CMT2L
  • DHMN2
  • E2IG1
  • HMN2A
  • HSP22
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
gene perturbation
0.95
PubMedID
0.95
kinase perturbation
0.84
small molecule perturbation
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 255.39   (req: < 5)
Gene RIFs: 60   (req: <= 3)
Antibodies: 552   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 255.39   (req: >= 5)
Gene RIFs: 60   (req: > 3)
Antibodies: 552   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Cellular response to heat stress (R-HSA-3371556)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular response to heat stress
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
HSF1-dependent transactivation
Name
Explore in Pharos
Explore in Source
Cellular response to heat stress
Cellular responses to external stimuli
Cellular responses to stress
HSF1-dependent transactivation
Protein-Protein Interactions (96)
1 – 10 of 96
LONRF2
Tdark
Family: Enzyme
Novelty: 2.93023256
p_int: 0.999993841
p_ni: 0.000006159
Score: 0.221
Data Source: BioPlex,STRINGDB
IRAK3
Tchem
Family: Kinase
Novelty: 0.01432197
p_int: 0.999885915
p_ni: 0.00002936
p_wrong: 0.000084726
Data Source: BioPlex
NUDT12
Tbio
Family: Enzyme
Novelty: 0.40327445
p_int: 0.998678337
p_ni: 0.001214681
p_wrong: 0.000106981
Score: 0.392
Data Source: BioPlex,STRINGDB
BRCA2
Tbio
Novelty: 0.00031192
p_int: 0.994084632
p_ni: 0.005915368
Data Source: BioPlex
FAM83H
Tbio
Novelty: 0.03310744
p_int: 0.993780754
p_ni: 0.006219246
Data Source: BioPlex
ACAD11
Tbio
Family: Enzyme
Novelty: 0.55263158
p_int: 0.99177725
p_ni: 0.00822275
Data Source: BioPlex
SETD2
Tchem
Family: Epigenetic
Novelty: 0.00129405
p_int: 0.989616618
p_ni: 0.010383382
Score: 0.181
Data Source: BioPlex,STRINGDB
BAG3
Tbio
Novelty: 0.00469463
p_int: 0.987744442
p_ni: 0.012255558
Score: 0.925
Data Source: BioPlex,STRINGDB
VWA8
Tdark
Novelty: 0.39325843
p_int: 0.987013261
p_ni: 0.012986739
Score: 0.392
Data Source: BioPlex,STRINGDB
ZNF92
Tbio
Family: TF
Novelty: 0.07755792
p_int: 0.942822356
p_ni: 0.056411924
p_wrong: 0.00076572
Data Source: BioPlex
Publication Statistics
PubMed Score  255.39

PubMed score by year
PubTator Score  88.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVP
1-70
RGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFT
70-140
KKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT
140-196
MADGQMPFSCHYPSRLRRDPFRDSPLSSRLLDDGFGMDPFPDDLTASWPDWALPRLSSAWPGTLRSGMVPRGPTATARFGVPAEGRTPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPPYSTFGESSFNNELPQDSQEVTCT