You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ROM1
Rod outer segment membrane protein 1

Protein Summary
Description
May function as an adhesion molecule involved in stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. It is essential for disk morphogenesis. This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS). It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000278833
  • ENSP00000278833
  • ENSG00000149489

Symbol
  • TSPAN23
  • ROM
  • RP7
  • ROSP1
  • TSPAN23
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.8
histone modification site profile
0.67
small molecule perturbation
0.59
tissue
0.59
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.54   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 71   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 109.54   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 71   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (110)
1 – 10 of 110
SPTLC2
Tchem
Family: Enzyme
Novelty: 0.01896868
p_int: 0.81147271
p_ni: 0.18852729
Score: 0.685
Data Source: BioPlex,STRINGDB
RHO
Tbio
Family: GPCR
Novelty: 0.00015258
Score: 0.883
Data Source: STRINGDB
NRL
Tbio
Family: TF
Novelty: 0.00331865
Score: 0.771
Data Source: STRINGDB
FTH1
Tbio
Novelty: 0.00088724
Score: 0.763
Data Source: STRINGDB
SAG
Tbio
Novelty: 0.00044383
Score: 0.763
Data Source: STRINGDB
PYGM
Tchem
Family: Enzyme
Novelty: 0.00573817
Score: 0.763
Data Source: STRINGDB
FOSL1
Tbio
Family: TF
Novelty: 0.00369713
Score: 0.763
Data Source: STRINGDB
CHRM1
Tclin
Family: GPCR
Novelty: 0.00648721
Score: 0.761
Data Source: STRINGDB
COX8A
Tbio
Family: Enzyme
Novelty: 0.00619913
Score: 0.759
Data Source: STRINGDB
AHNAK
Tbio
Novelty: 0.01530578
Score: 0.757
Data Source: STRINGDB
Publication Statistics
PubMed Score  109.54

PubMed score by year
PubTator Score  67.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAG
1-70
AVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTA
70-140
LAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTD
140-210
GVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQA
210-280
LVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSE
280-350
A
350-351
MAPVLPLVLPLQPRIRLAQGLWLLSWLLALAGGVILLCSGHLLVQLRHLGTFLAPSCQFPVLPQAALAAGAVALGTGLVGVGASRASLNAALYPPWRGVLGPLLVAGTAGGGGLLVVGLGLALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGSMLAVTFLLQALVLLGLRYLQTALEGLGGVIDAGGETQGYLFPSGLKDMLKTAWLQGGVACRPAPEEAPPGEAPPKEDLSEA