You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PRDM14
PR domain zinc finger protein 14

Protein Summary
Description
Transcription factor that has both positive and negative roles on transcription. Required for the maintenance of emryonic stem cell identity and the reacquisition of pluripotency in somatic cells. May play an essential role in germ cell development at 2 levels: the reacquisition of potential pluripotency, including SOX2 up-regulation, and successful epigenetic reprogramming, characterized by EHMT1 repression. Its association with CBFA2T2 is required for the functions in pluripotency and germ cell formation (By similarity). Directly up-regulates the expression of pluripotency gene POU5F1 through its proximal enhancer. Binds to the DNA consensus sequence 5'-GGTC[TC]CTAA-3'. This gene encodes a member of the PRDI-BF1 and RIZ homology domain containing (PRDM) family of transcriptional regulators. The encoded protein may possess histone methyltransferase activity and plays a critical role in cell pluripotency by suppressing the expression of differentiation marker genes. Expression of this ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000276594
  • ENSP00000276594
  • ENSG00000147596

Symbol
  • PFM11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.83
gene perturbation
0.74
PubMedID
0.65
cell line
0.64
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.35   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 388   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.35   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 388   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Transcriptional regulation of pluripotent stem cells
Name
Explore in Pharos
Explore in Source
Developmental Biology
Transcriptional regulation of pluripotent stem cells
Gene Ontology Terms (25)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (96)
1 – 10 of 96
CBFA2T2
Tbio
Novelty: 0.07078453
p_int: 1
Score: 0.984
Data Source: BioPlex,STRINGDB
RUNX1T1
Tbio
Novelty: 0.00144196
p_int: 0.99999998
p_ni: 1e-8
p_wrong: 1e-8
Score: 0.428
Data Source: BioPlex,STRINGDB
STRIP2
Tbio
Novelty: 0.15494343
p_int: 0.99999813
p_ni: 0.00000187
Score: 0.206
Data Source: BioPlex,STRINGDB
PRDM6
Tbio
Family: TF; Epigenetic
Novelty: 0.06348253
p_int: 0.999993971
p_ni: 6.16e-7
p_wrong: 0.000005413
Score: 0.854
Data Source: BioPlex,STRINGDB
CBFA2T3
Tbio
Novelty: 0.01290799
p_int: 0.99996719
p_ni: 5.3e-8
p_wrong: 0.000032757
Score: 0.595
Data Source: BioPlex,STRINGDB
STRIP1
Tbio
Novelty: 0.15362107
p_int: 0.999947376
p_ni: 0.000052624
Data Source: BioPlex
CTTNBP2NL
Tbio
Novelty: 0.86196127
p_int: 0.999942384
p_ni: 0.000057616
Data Source: BioPlex
STRN3
Tbio
Novelty: 0.15807301
p_int: 0.999342401
p_ni: 0.000657599
Data Source: BioPlex
STRN4
Tbio
Novelty: 0.14202711
p_int: 0.999227649
p_ni: 0.000772351
Data Source: BioPlex
STRN
Tbio
Novelty: 0.01561194
p_int: 0.999094523
p_ni: 0.000905477
Data Source: BioPlex
Publication Statistics
PubMed Score  50.35

PubMed score by year
PubTator Score  28.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAASAAPAMPPFP
1-70
FRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHEYAGASSEDLGHQIIGGDNES
70-140
GPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSEDGPKPSNQEGKSPARFQFTEEDLHFVLYGVT
140-210
PSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRF
210-280
GPFQGKVVNASEVKTYGDNSVMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFY
280-350
ESCKEIHQNQELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLK
350-420
YTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHMRVHSGDRPYQ
420-490
CVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSHKEDDGCSCSICGKIFSDQET
490-560
FYSHMKFHEDY
560-571
MALPRPSEAVPQDKVCYPPESSPQNLAAYYTPFPSYGHYRNSLATVEEDFQPFRQLEAAASAAPAMPPFPFRMAPPLLSPGLGLQREPLYDLPWYSKLPPWYPIPHVPREVPPFLSSSHEYAGASSEDLGHQIIGGDNESGPCCGPDTLIPPPPADASLLPEGLRTSQLLPCSPSKQSEDGPKPSNQEGKSPARFQFTEEDLHFVLYGVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQTVFGEVPHFGVFCSSFIAKGVRFGPFQGKVVNASEVKTYGDNSVMWEIFEDGHLSHFIDGKGGTGNWMSYVNCARFPKEQNLVAVQCQGHIFYESCKEIHQNQELLVWYGDCYEKFLDIPVSLQVTEPGKQPSGPSEESAEGYRCERCGKVFTYKYYRDKHLKYTPCVDKGDRKFPCSLCKRSFEKRDRLRIHILHVHEKHRPHKCSTCGKCFSQSSSLNKHMRVHSGDRPYQCVYCTKRFTASSILRTHIRQHSGEKPFKCKYCGKSFASHAAHDSHVRRSHKEDDGCSCSICGKIFSDQETFYSHMKFHEDY