Protein Classes
Protein Summary
Hormone regulating the release of corticotropin from pituitary gland (By similarity). Induces NLRP6 in intestinal epithelial cells, hence may influence gut microbiota profile (By similarity). This gene encodes a member of the corticotropin-releasing factor family. The encoded preproprotein is proteolytically processed to generate the mature neuropeptide hormone. In response to stress, this hormone is secreted by the paraventricular nucleus (PVN) of the hypothalamus, binds to corticotropin releasing hormone receptors and stimulates the release of adrenocorticotropic hormone from the pituitary gland. Marked reduction in this protein has been observed in association with Alzheimer's disease. Autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, this protein is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expresse ...more
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 5892.11 (req: < 5)
Gene RIFs: 145 (req: <= 3)
Antibodies: 507 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 5892.11 (req: >= 5)
Gene RIFs: 145 (req: > 3)
Antibodies: 507 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 55
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (42)
Reactome (11)
KEGG (4)
PathwayCommons (8)
WikiPathways (19)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 11
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Class B/2 (Secretin family receptors) | ||||
Reactome | G alpha (s) signalling events | ||||
Reactome | GPCR downstream signalling | ||||
Reactome | GPCR ligand binding | ||||
Reactome | Gene expression (Transcription) | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Class B/2 (Secretin family receptors) | ||||
G alpha (s) signalling events | ||||
GPCR downstream signalling | ||||
GPCR ligand binding | ||||
Gene expression (Transcription) | ||||
Gene Ontology Terms (60)
Functions (6)
Components (5)
Processes (49)
Items per page:
10
1 – 6 of 6
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Traceable Author Statement (TAS) | ProtInc | |||
Traceable Author Statement (TAS) | ProtInc | |||
Traceable Author Statement (TAS) | ProtInc | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Inferred from Electronic Annotation (IEA) | Ensembl | |||
Protein-Protein Interactions (276)
1 – 10 of 276
UBR1
Family: Enzyme
Novelty: 0.00742688
p_int: 0.983391919
p_ni: 0.016608081
Score: 0.187
Data Source: BioPlex,STRINGDB
RRAS
Family: Enzyme
Novelty: 0.00229703
p_int: 0.825752109
p_ni: 0.16124927
p_wrong: 0.012998621
Score: 0.319
Data Source: BioPlex,STRINGDB
CRHR2
Family: GPCR
Novelty: 0.00324955
Score: 0.999
Data Source: Reactome,STRINGDB
CRHR1
Family: GPCR
Novelty: 0.00121307
Score: 0.999
Data Source: Reactome,STRINGDB
POMC
Novelty: 0.00002654
Score: 0.997
Data Source: STRINGDB
CRHBP
Novelty: 0.00918779
Score: 0.996
Data Source: Reactome,STRINGDB
UCN
Novelty: 0.00171727
Score: 0.993
Data Source: STRINGDB
AVP
Novelty: 0.0001163
Score: 0.99
Data Source: STRINGDB
NPS
Novelty: 0.00011983
Score: 0.985
Data Source: STRINGDB
MC4R
Family: GPCR
Novelty: 0.00104053
Score: 0.979
Data Source: STRINGDB
Publication Statistics
PubMed Score 5892.11
PubMed score by year
PubTator Score 5424.69
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGE
1-70
EYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNA
70-140
LGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
140-196
MRLPLLVSAGVLLVALLPCPPCRALLSRGPVPGARQAPQHPQPLDFFQPPPQSEQPQQPQARPVLLRMGEEYFLRLGNLNKSPAAPLSPASSLLAGGSGSRPSPEQATANFFRVLLQQLLLPRRSLDSPAALAERGARNALGGHQEAPERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Find similar targets by: