You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CCNA2
Cyclin-A2

Protein Summary
Description
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle. The protein encoded by this gene belongs to the highly conserved cyclin family, whose members function as regulators of the cell cycle. This protein binds and activates cyclin-dependent kinase 2 and thus promotes transition through G1/S and G2/M. [provided by RefSeq, Aug 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000274026
  • ENSP00000274026
  • ENSG00000145386
  • ENST00000618014
  • ENSP00000481380

Symbol
  • CCN1
  • CCNA
  • CCN1
  • CCNA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
0.99
drug
0.97
kinase perturbation
0.95
co-expressed gene
0.93
virus
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1395.44   (req: < 5)
Gene RIFs: 122   (req: <= 3)
Antibodies: 731   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1395.44   (req: >= 5)
Gene RIFs: 122   (req: > 3)
Antibodies: 731   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (1)
1 – 1 of 1
CHEMBL488436
chemical structure image
Protein Data Bank (90)
1 – 5 of 90
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (351)
APC/C-mediated degradation of cell cycle proteins (R-HSA-174143)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 55
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
APC/C-mediated degradation of cell cycle proteins
Reactome
APC/C:Cdc20 mediated degradation of mitotic proteins
Reactome
APC:Cdc20 mediated degradation of cell cycle proteins prior to satisfation of the cell cycle checkpoint
Reactome
Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins
Reactome
CDK-mediated phosphorylation and removal of Cdc6
Name
Explore in Pharos
Explore in Source
APC/C-mediated degradation of cell cycle proteins
APC/C:Cdc20 mediated degradation of mitotic proteins
APC:Cdc20 mediated degradation of cell cycle proteins prior to satisfation of the cell cycle checkpoint
Activation of APC/C and APC/C:Cdc20 mediated degradation of mitotic proteins
CDK-mediated phosphorylation and removal of Cdc6
Protein-Protein Interactions (609)
1 – 10 of 609
CDK2
Tchem
Family: Kinase
Novelty: 0.00033882
p_int: 1
Score: 0.999
Data Source: BioPlex,STRINGDB
CKS1B
Tbio
Family: Enzyme
Novelty: 0.00986309
p_int: 1
Score: 0.998
Data Source: BioPlex,STRINGDB
FZR1
Tbio
Novelty: 0.01409033
p_int: 1
Score: 0.979
Data Source: BioPlex,STRINGDB
GMNN
Tbio
Novelty: 0.00563598
p_int: 0.999999999
p_ni: 1e-9
Score: 0.943
Data Source: BioPlex,STRINGDB
CDK3
Tchem
Family: Kinase
Novelty: 0.04846001
p_int: 0.999999999
p_ni: 1e-9
Score: 0.931
Data Source: BioPlex,STRINGDB
HELB
Tbio
Family: Enzyme
Novelty: 0.0069528
p_int: 0.999999998
p_ni: 2e-9
Score: 0.364
Data Source: BioPlex,STRINGDB
SCAPER
Tbio
Family: Enzyme
Novelty: 0.08645533
p_int: 0.999999997
p_ni: 3e-9
Score: 0.637
Data Source: BioPlex,STRINGDB
RBL1
Tbio
Novelty: 0.00255302
p_int: 0.999999984
p_ni: 1.6e-8
Score: 0.995
Data Source: BioPlex,STRINGDB
PKMYT1
Tchem
Family: Kinase
Novelty: 0.04783054
p_int: 0.999999982
p_ni: 1.2e-8
p_wrong: 7e-9
Score: 0.994
Data Source: BioPlex,STRINGDB
CKS2
Tbio
Family: Enzyme
Novelty: 0.03208125
p_int: 0.999999974
p_ni: 2.6e-8
Score: 0.992
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  1395.44

PubMed score by year
PubTator Score  1330.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR
1-70
RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP
70-140
LVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM
140-210
RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY
210-280
ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY
280-350
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG
350-420
VSLLNPPETLNL
420-432
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL