You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ENOPH1
Enolase-phosphatase E1

Protein Summary
Description
Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000273920
  • ENSP00000273920
  • ENSG00000145293
  • ENST00000505846
  • ENSP00000427209

Symbol
  • MASA
  • E1
  • MASA
  • mtnC
  • MST145
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
transcription factor binding site profile
0.81
transcription factor
0.79
transcription factor perturbation
0.74
tissue sample
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.04   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 142   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.04   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 142   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of amino acids and derivatives
Reactome
Methionine salvage pathway
Reactome
Sulfur amino acid metabolism
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of amino acids and derivatives
Methionine salvage pathway
Sulfur amino acid metabolism
Gene Ontology Terms (8)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Protein-Protein Interactions (73)
1 – 10 of 73
RNF41
Tbio
Family: Enzyme
Novelty: 0.02458297
p_int: 0.999980051
p_ni: 0.000019948
p_wrong: 1e-9
Score: 0.366
Data Source: BioPlex,STRINGDB
CARD9
Tbio
Family: Enzyme
Novelty: 0.00825918
p_int: 0.999906185
p_ni: 0.000093814
p_wrong: 1e-9
Score: 0.825
Data Source: BioPlex,STRINGDB
THEM4
Tbio
Family: Enzyme
Novelty: 0.00511448
p_int: 0.999215802
p_ni: 0.000784198
Score: 0.679
Data Source: BioPlex,STRINGDB
VPS52
Tbio
Novelty: 0.01835289
p_int: 0.997358269
p_ni: 0.002641731
Score: 0.244
Data Source: BioPlex,STRINGDB
APIP
Tbio
Family: Enzyme
Novelty: 0.12194478
Score: 0.997
Data Source: STRINGDB
ADI1
Tbio
Family: Enzyme
Novelty: 0.00865728
Score: 0.996
Data Source: STRINGDB
SMS
Tchem
Family: Enzyme
Novelty: 0.03313893
Score: 0.955
Data Source: STRINGDB
MRI1
Tbio
Family: Enzyme
Novelty: 0.00421775
Score: 0.921
Data Source: STRINGDB
PGM3
Tbio
Family: Enzyme
Novelty: 0.00597595
Score: 0.874
Data Source: STRINGDB
EEF1B2
Tbio
Novelty: 0.01458139
Score: 0.869
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.04

PubMed score by year
PubTator Score  14.88

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLD
1-70
GAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVR
70-140
KWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFL
140-210
TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
210-261
MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST