You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ABHD14A
Protein ABHD14A

Protein Summary
Description
Possible role in granule neuron development.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000273596
  • ENSP00000273596
  • ENSG00000248487

Symbol
  • DORZ1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.95
histone modification site profile
0.79
transcription factor perturbation
0.68
gene perturbation
0.65
tissue
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.57   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 120   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.57   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 120   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (55)
1 – 10 of 55
SLC39A12
Tbio
Family: Transporter
Novelty: 0.11255353
p_int: 0.984870979
p_ni: 0.015125871
p_wrong: 0.00000315
Data Source: BioPlex
IL13RA2
Tbio
Novelty: 0.04900852
p_int: 0.969797827
p_ni: 0.03020216
p_wrong: 1.3e-8
Data Source: BioPlex
CEACAM21
Tdark
Novelty: 0.98765432
p_int: 0.961374736
p_ni: 0.038625217
p_wrong: 4.7e-8
Data Source: BioPlex
SCARA3
Tbio
Novelty: 0.00826861
p_int: 0.949631709
p_ni: 0.050368291
Data Source: BioPlex
CD1E
Tbio
Novelty: 0.00231902
p_int: 0.927536271
p_ni: 0.072463729
Data Source: BioPlex
SLC39A5
Tbio
Family: Transporter
Novelty: 0.06778122
p_int: 0.926359192
p_ni: 0.073640808
Data Source: BioPlex
A4GALT
Tbio
Family: Enzyme
Novelty: 0.00253249
p_int: 0.894867248
p_ni: 0.105122593
p_wrong: 0.000010159
Score: 0.252
Data Source: BioPlex,STRINGDB
GGT7
Tbio
Family: Enzyme
Novelty: 0.0180475
p_int: 0.880854649
p_ni: 0.119111568
p_wrong: 0.000033783
Score: 0.153
Data Source: BioPlex,STRINGDB
TCTN2
Tdark
Novelty: 0.19568118
p_int: 0.87320657
p_ni: 0.126793412
p_wrong: 1.8e-8
Data Source: BioPlex
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
p_int: 0.872444896
p_ni: 0.098491678
p_wrong: 0.029063426
Data Source: BioPlex
Publication Statistics
PubMed Score  0.57

PubMed score by year
PubTator Score  0.09

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTSCLWGDPNVTV
1-70
LAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPS
70-140
KEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAV
140-210
KTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP
210-271
MVGALCGCWFRLGGARPLIPLGPTVVQTSMSRSQVALLGLSLLLMLLLYVGLPGPPEQTSCLWGDPNVTVLAGLTPGNSPIFYREVLPLNQAHRVEVVLLHGKAFNSHTWEQLGTLQLLSQRGYRAVALDLPGFGNSAPSKEASTEAGRAALLERALRDLEVQNAVLVSPSLSGHYALPFLMRGHHQLHGFVPIAPTSTQNYTQEQFWAVKTPTLILYGELDHILARESLRQLRHLPNHSVVKLRNAGHACYLHKPQDFHLVLLAFLDHLP