You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WDPCP
WD repeat-containing and planar cell polarity effector protein fritz homolog

Protein Summary
Description
Probable effector of the planar cell polarity signaling pathway which regulates the septin cytoskeleton in both ciliogenesis and collective cell movements. Together with FUZ and WDPCP proposed to function as core component of the CPLANE (ciliogenesis and planar polarity effectors) complex involved in the recruitment of peripheral IFT-A proteins to basal bodies (By similarity). This gene encodes a cytoplasmic WD40 repeat protein. A similar gene in frogs encodes a planar cell polarity protein that plays a critical role in collective cell movement and ciliogenesis by mediating septin localization. Mutations in this gene are associated with Bardet-Biedl syndrome 15 and may also play a role in Meckel-Gruber syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000272321
  • ENSP00000272321
  • ENSG00000143951
  • ENST00000398544
  • ENSP00000381552
  • ENST00000409562
  • ENSP00000387222

Symbol
  • BBS15
  • C2orf86
  • FRITZ
  • FRTZ
  • BBS15
  • FRITZ
  • CHDTHP
  • C2orf86
  • CPLANE5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.82
cellular component
0.72
cell type or tissue
0.68
biological process
0.66
transcription factor binding site profile
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.64   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 97   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 8.64   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 97   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Genes related to primary cilium development (based on CRISPR)
Name
Explore in Pharos
Explore in Source
Genes related to primary cilium development (based on CRISPR)
Gene Ontology Terms (22)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (59)
1 – 10 of 59
INTU
Tbio
Novelty: 0.01681468
Score: 0.891
Data Source: STRINGDB
FUZ
Tbio
Novelty: 0.02632541
Score: 0.765
Data Source: STRINGDB
TBC1D32
Tbio
Novelty: 0.67741935
Score: 0.759
Data Source: STRINGDB
TTC25
Tdark
Novelty: 0.3125
Score: 0.735
Data Source: STRINGDB
SDCCAG8
Tbio
Novelty: 0.06798507
Score: 0.684
Data Source: STRINGDB
MKS1
Tbio
Novelty: 0.03872544
Score: 0.679
Data Source: STRINGDB
BBS12
Tbio
Novelty: 0.08359873
Score: 0.678
Data Source: STRINGDB
TTC8
Tbio
Novelty: 0.21546939
Score: 0.674
Data Source: STRINGDB
BBS10
Tbio
Novelty: 0.04807564
Score: 0.669
Data Source: STRINGDB
SEPT2
Tbio
Novelty: 0.00437406
Score: 0.661
Data Source: STRINGDB
Publication Statistics
PubMed Score  8.64

PubMed score by year
PubTator Score  13.06

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRREFCWDAYSKAAGSRASSPLPRQDRDSFCHQMSFCLTELHLWSLKNTLHIADRDIGIYQYYDKKDPPA
1-70
TEHGNLEKKQKLAESRDYPWTLKNRRPEKLRDSLKELEELMQNSRCVLSKWKNKYVCQLLFGSGVLVSLS
70-140
LSGPQLEKVVIDRSLVGKLISDTISDALLTDSFIILSFLAQNKLCFIQFTKKMESSDVNKRLEKLSALDY
140-210
KIFYYEIPGPINKTTERHLAINCVHDRVVCWWPLVNDDAWPWAPISSEKDRANLLLLGYAQGRLEVLSSV
210-280
RTEWDPLDVRFGTKQPYQVFTVEHSVSVDKEPMADSCIYECIRNKIQCVSVTRIPLKSKAISCCRNVTED
280-350
KLILGCEDSSLILYETHRRVTLLAQTELLPSLISCHPSGAILLVGSNQGELQIFDMALSPINIQLLAEDR
350-420
LPRETLQFSKLFDASSSLVQMQWIAPQVVSQKGEGSDIYDLLFLRFERGPLGVLLFKLGVFTRGQLGLID
420-490
IIFQYIHCDEIYEAINILSSMNWDTLGHQCFISMSAIVNHLLRQKLTPEREAQLETSLGTFYAPTRPLLD
490-560
STILEYRDQISKYARRFFHHLLRYQRFEKAFLLAVDVGARDLFMDIHYLALDKGELALAEVARKRASDID
560-630
AESITSGVELLGPLDRGDMLNEAFIGLSLAPQGEDSFPDNLPPSCPTHRHILQQRILNGSSNRQIIDRRN
630-700
ELEKDICSGFLMTNTCNAEDGELREDGREQEIRDGGSLKMIHFGLV
700-746
MRREFCWDAYSKAAGSRASSPLPRQDRDSFCHQMSFCLTELHLWSLKNTLHIADRDIGIYQYYDKKDPPATEHGNLEKKQKLAESRDYPWTLKNRRPEKLRDSLKELEELMQNSRCVLSKWKNKYVCQLLFGSGVLVSLSLSGPQLEKVVIDRSLVGKLISDTISDALLTDSFIILSFLAQNKLCFIQFTKKMESSDVNKRLEKLSALDYKIFYYEIPGPINKTTERHLAINCVHDRVVCWWPLVNDDAWPWAPISSEKDRANLLLLGYAQGRLEVLSSVRTEWDPLDVRFGTKQPYQVFTVEHSVSVDKEPMADSCIYECIRNKIQCVSVTRIPLKSKAISCCRNVTEDKLILGCEDSSLILYETHRRVTLLAQTELLPSLISCHPSGAILLVGSNQGELQIFDMALSPINIQLLAEDRLPRETLQFSKLFDASSSLVQMQWIAPQVVSQKGEGSDIYDLLFLRFERGPLGVLLFKLGVFTRGQLGLIDIIFQYIHCDEIYEAINILSSMNWDTLGHQCFISMSAIVNHLLRQKLTPEREAQLETSLGTFYAPTRPLLDSTILEYRDQISKYARRFFHHLLRYQRFEKAFLLAVDVGARDLFMDIHYLALDKGELALAEVARKRASDIDAESITSGVELLGPLDRGDMLNEAFIGLSLAPQGEDSFPDNLPPSCPTHRHILQQRILNGSSNRQIIDRRNELEKDICSGFLMTNTCNAEDGELREDGREQEIRDGGSLKMIHFGLV