You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ACP4
Testicular acid phosphatase

Protein Summary
Description
May dephosphorylate receptor tyrosine-protein kinase ERBB4 and inhibits its ligand-induced proteolytic cleavage (PubMed:15219672). May play a role in odontogenesis (PubMed:27843125). Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression in testicular cancer tissues than in normal tissues. The protein encoded by this gene has structural similarity to prostatic and lysosomal acid phosphatases. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000270593
  • ENSP00000270593
  • ENSG00000142513

Symbol
  • ACPT
  • ACPT
  • AI1J
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.59   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 76   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.59   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 76   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (56)
1 – 10 of 56
ROGDI
Tbio
Novelty: 0.07032696
Score: 0.725
Data Source: STRINGDB
GRM4
Tchem
Family: GPCR
Novelty: 0.00432322
Score: 0.708
Data Source: STRINGDB
CPTP
Tbio
Novelty: 0.02196847
Score: 0.708
Data Source: STRINGDB
SMYD4
Tdark
Family: Epigenetic
Novelty: 0.39298246
Score: 0.703
Data Source: STRINGDB
GRM8
Tchem
Family: GPCR
Novelty: 0.00998475
Score: 0.689
Data Source: STRINGDB
LSP1
Tbio
Novelty: 0.01170291
Score: 0.689
Data Source: STRINGDB
ACOT11
Tbio
Family: Enzyme
Novelty: 0.00262976
Score: 0.68
Data Source: STRINGDB
KLK4
Tchem
Family: Enzyme
Novelty: 0.00021411
Score: 0.676
Data Source: STRINGDB
GRM7
Tchem
Family: GPCR
Novelty: 0.00478841
Score: 0.675
Data Source: STRINGDB
KLK1
Tchem
Family: Enzyme
Novelty: 0.00205352
Score: 0.643
Data Source: STRINGDB
Publication Statistics
PubMed Score  44.59

PubMed score by year
PubTator Score  6.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQL
1-70
TTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIP
70-140
VHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLD
140-210
TLMCQQAHGLPLPAWASPDVLRTLAQISALDIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPL
210-280
KMVMYSAHDSTLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSL
280-350
PGCPAPCPLGRFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR
350-420
ALGGPV
420-426
MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQLTTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIPVHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAWASPDVLRTLAQISALDIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLGRFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLRALGGPV