You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SLC6A3
Sodium-dependent dopamine transporter

Protein Summary
Description
Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals. This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3' UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.[provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000270349
  • ENSP00000270349
  • ENSG00000142319
  • ENST00000621716
  • ENSP00000479597
  • ENSG00000276996

Symbol
  • DAT1
  • DAT
  • DAT1
  • PKDYS
  • PKDYS1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug
1
molecular function
0.99
chemical
0.97
gene perturbation
0.92
biological process
0.89


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3892.33   (req: < 5)
Gene RIFs: 575   (req: <= 3)
Antibodies: 410   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3892.33   (req: >= 5)
Gene RIFs: 575   (req: > 3)
Antibodies: 410   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 1731
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 47
Active Ligands (1731)
1 – 10 of 1731
CHEMBL1201203
chemical structure image
CHEMBL2079586
chemical structure image
CHEMBL83729,CHEMBL1790051
chemical structure image
CHEMBL14370
chemical structure image
CHEMBL528995
chemical structure image
CHEMBL295467
chemical structure image
CHEMBL356750,CHEMBL1788140
chemical structure image
CHEMBL1173532
chemical structure image
CHEMBL608151
chemical structure image
Pathways (27)
Defective SLC6A3 causes Parkinsonism-dystonia infantile (PKDYS) (R-HSA-5619081)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Defective SLC6A3 causes Parkinsonism-dystonia infantile (PKDYS)
Reactome
Disease
Reactome
Disorders of transmembrane transporters
Reactome
Dopamine clearance from the synaptic cleft
Reactome
Na+/Cl- dependent neurotransmitter transporters
Name
Explore in Pharos
Explore in Source
Defective SLC6A3 causes Parkinsonism-dystonia infantile (PKDYS)
Disease
Disorders of transmembrane transporters
Dopamine clearance from the synaptic cleft
Na+/Cl- dependent neurotransmitter transporters
Gene Ontology Terms (42)
Items per page:
10
1 – 10 of 10
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (147)
1 – 10 of 147
DRD2
Tclin
Family: GPCR
Novelty: 0.00028344
Score: 0.99
Data Source: STRINGDB
SNCA
Tchem
Novelty: 0.00021357
Score: 0.983
Data Source: STRINGDB
SLC18A2
Tclin
Family: Transporter
Novelty: 0.00096437
Score: 0.954
Data Source: STRINGDB
STX1A
Tbio
Novelty: 0.00128938
Score: 0.952
Data Source: STRINGDB
TH
Tclin
Family: Enzyme
Novelty: 0.00030927
Score: 0.928
Data Source: STRINGDB
FLOT1
Tbio
Novelty: 0.00698552
Score: 0.919
Data Source: STRINGDB
FLOT2
Tbio
Novelty: 0.0094098
Score: 0.903
Data Source: STRINGDB
CDH1
Tbio
Novelty: 0.0001303
Score: 0.902
Data Source: STRINGDB
DRD4
Tchem
Family: GPCR
Novelty: 0.00047256
Score: 0.898
Data Source: STRINGDB
DRD1
Tclin
Family: GPCR
Novelty: 0.0005535
Score: 0.892
Data Source: STRINGDB
Publication Statistics
PubMed Score  3892.33

PubMed score by year
PubTator Score  3176.87

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFL
1-70
LSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKG
70-140
VGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGT
140-210
TPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTAL
210-280
LLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTT
280-350
SINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
350-420
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLI
420-490
EAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANAL
490-560
GWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV
560-620
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDRETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELALGQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQLTACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSVDFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSSGFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGIDSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAAGTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSIVTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKDRELVDRGEVRQFTLRHWLKV