You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GATA6
Transcription factor GATA-6

Protein Summary
Description
Transcriptional activator (PubMed:19666519, PubMed:27756709, PubMed:22750565, PubMed:22824924). Regulates SEMA3C and PLXNA2 (PubMed:19666519). Involved in gene regulation specifically in the gastric epithelium (PubMed:9315713). May regulate genes that protect epithelial cells from bacterial infection (PubMed:16968778). Involved in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression (By similarity). Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (By similarity). This gene is a member of a small family of zinc finger transcription factors that play an important role in the regulation of cellular differentiation and organogenesis during vertebrate development. This gene is expressed during early embryogenesis and localizes to endo- and mesodermally derived cells during later embryogenesis and thereby plays an important role in gut, lung, and heart development. Mutations in this gene are associated with several congenital defect ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000269216
  • ENSP00000269216
  • ENSG00000141448
  • ENST00000581694
  • ENSP00000462313
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
PubMedID
0.99
molecular function
0.97
transcription factor binding site profile
0.83
gene perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 302.42   (req: < 5)
Gene RIFs: 106   (req: <= 3)
Antibodies: 472   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 302.42   (req: >= 5)
Gene RIFs: 106   (req: > 3)
Antibodies: 472   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 50
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (12)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Hemostasis
Reactome
Metabolism of proteins
Reactome
POU5F1 (OCT4), SOX2, NANOG repress genes related to differentiation
Name
Explore in Pharos
Explore in Source
Developmental Biology
Factors involved in megakaryocyte development and platelet production
Hemostasis
Metabolism of proteins
POU5F1 (OCT4), SOX2, NANOG repress genes related to differentiation
Gene Ontology Terms (54)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (200)
1 – 10 of 200
EIF1AD
Tdark
Novelty: 0.26086957
p_int: 0.821251539
p_ni: 0.000002797
p_wrong: 0.178745663
Data Source: BioPlex
ZFPM2
Tbio
Family: TF
Novelty: 0.01483815
Score: 0.962
Data Source: STRINGDB
GATA5
Tbio
Family: TF
Novelty: 0.0101933
Score: 0.955
Data Source: STRINGDB
LMCD1
Tbio
Novelty: 0.09706539
Score: 0.947
Data Source: Reactome,STRINGDB
ZFPM1
Tbio
Family: TF
Novelty: 0.00277855
Score: 0.946
Data Source: STRINGDB
HEY2
Tbio
Family: TF
Novelty: 0.00341896
Score: 0.946
Data Source: STRINGDB
HEY1
Tbio
Family: TF
Novelty: 0.00474879
Score: 0.942
Data Source: STRINGDB
GATA4
Tbio
Family: TF
Novelty: 0.00115226
Score: 0.941
Data Source: STRINGDB
GATA1
Tbio
Family: TF
Novelty: 0.0009412
Score: 0.932
Data Source: STRINGDB
GATA2
Tbio
Family: TF
Novelty: 0.00178271
Score: 0.93
Data Source: STRINGDB
Publication Statistics
PubMed Score  302.42

PubMed score by year
PubTator Score  207.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAA
1-70
AGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFA
70-140
PEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGS
140-210
GPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPG
210-280
GYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWP
280-350
AGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKM
350-420
NGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQT
420-490
RKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSEL
490-560
KYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
560-595
MALTDGGWCLPKRFGAAGADASDSRAFPAREPSTPPSPISSSSSSCSRGGERGPGGASNCGTPQLDTEAAAGPPARSLLLSSYASHPFGAPHGPSAPGVAGPGGNLSSWEDLLLFTDLDQAATASKLLWSSRGAKLSPFAPEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLPGLPYHLQGSGSGPANHAGGAGAHPGWPQASADSPPYGSGGGAAGGGAAGPGGAGSAAAHVSARFPYSPSPPMANGAAREPGGYAAAGSGGAGGVSGGGSSLAAMGGREPQYSSLSAARPLNGTYHHHHHHHHHHPSPYSPYVGAPLTPAWPAGPFETPVLHSLQSRAGAPLPVPRGPSADLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA