You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CDH2
Cadherin-2

Protein Summary
Description
Calcium-dependent cell adhesion protein; preferentially mediates homotypic cell-cell adhesion by dimerization with a CDH2 chain from another cell. Cadherins may thus contribute to the sorting of heterogeneous cell types. Acts as a regulator of neural stem cells quiescence by mediating anchorage of neural stem cells to ependymocytes in the adult subependymal zone: upon cleavage by MMP24, CDH2-mediated anchorage is affected, leading to modulate neural stem cell quiescence. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density. This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the for ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000269141
  • ENSP00000269141
  • ENSG00000170558
  • ENST00000399380
  • ENSP00000382312

Symbol
  • CDHN
  • NCAD
  • CDHN
  • NCAD
  • CD325
  • CDw325
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
transcription factor perturbation
0.94
protein domain
0.92
disease
0.86
virus perturbation
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1585.46   (req: < 5)
Gene RIFs: 229   (req: <= 3)
Antibodies: 1516   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1585.46   (req: >= 5)
Gene RIFs: 229   (req: > 3)
Antibodies: 1516   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 40
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (81)
Adherens junctions interactions (R-HSA-418990)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adherens junctions interactions
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-cell junction organization
Reactome
Developmental Biology
Name
Explore in Pharos
Explore in Source
Adherens junctions interactions
Cell junction organization
Cell-Cell communication
Cell-cell junction organization
Developmental Biology
Gene Ontology Terms (64)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (472)
1 – 10 of 472
CTNNA3
Tbio
Novelty: 0.02196369
p_int: 0.992033066
p_ni: 0.007966931
p_wrong: 3e-9
Score: 0.576
Data Source: BioPlex,STRINGDB
TAX1BP3
Tbio
Novelty: 0.01762102
p_int: 0.95758017
p_ni: 0.04241983
Data Source: BioPlex
JUP
Tbio
Novelty: 0.01122537
Score: 0.994
Data Source: STRINGDB
CTNNB1
Tchem
Novelty: 0.00008951
Score: 0.994
Data Source: Reactome,STRINGDB
GJA1
Tbio
Novelty: 0.00023576
Score: 0.99
Data Source: STRINGDB
CTNNA1
Tbio
Novelty: 0.0104485
Score: 0.989
Data Source: Reactome,STRINGDB
CTNND1
Tbio
Novelty: 0.00399968
Score: 0.983
Data Source: STRINGDB
FN1
Tchem
Novelty: 0.0000437
Score: 0.981
Data Source: STRINGDB
FGFR1
Tclin
Family: Kinase
Novelty: 0.00068893
Score: 0.979
Data Source: STRINGDB
AXIN1
Tbio
Novelty: 0.00280253
Score: 0.975
Data Source: STRINGDB
Publication Statistics
PubMed Score  1585.46

PubMed score by year
PubTator Score  1246.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQ
1-70
YESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEE
70-140
IVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIF
140-210
IINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGS
210-280
KPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQ
280-350
ATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
350-420
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVID
420-490
VNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLD
490-560
RESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDI
560-630
DPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKV
630-700
CQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNI
700-770
LKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
770-840
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD
840-906
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKFSNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVYRISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDPANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDINDNAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGDFAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGLGTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGLKAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADMYGGGDD