You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
G6PC3
Glucose-6-phosphatase 3

Protein Summary
Description
Hydrolyzes glucose-6-phosphate to glucose in the endoplasmic reticulum. May form with the glucose-6-phosphate transporter (SLC37A4/G6PT) a ubiquitously expressed complex responsible for glucose production through glycogenolysis and gluconeogenesis. Probably required for normal neutrophil function. This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000269097
  • ENSP00000269097
  • ENSG00000141349

Symbol
  • UGRP
  • SCN4
  • UGRP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.68
transcription factor binding site profile
0.66
phenotype
0.61
tissue sample
0.59
transcription factor
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.25   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 69   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.25   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 69   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (152)
Disease (R-HSA-1643685)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Disease
Reactome
Diseases of carbohydrate metabolism
Reactome
Diseases of metabolism
Reactome
Gluconeogenesis
Reactome
Glucose metabolism
Name
Explore in Pharos
Explore in Source
Disease
Diseases of carbohydrate metabolism
Diseases of metabolism
Gluconeogenesis
Glucose metabolism
Gene Ontology Terms (8)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
UniProtKB
Protein-Protein Interactions (53)
1 – 10 of 53
GCK
Tchem
Family: Kinase
Novelty: 0.00134013
Score: 0.932
Data Source: STRINGDB
LCT
Tbio
Family: Enzyme
Novelty: 0.00221691
Score: 0.916
Data Source: STRINGDB
GPI
Tbio
Family: Enzyme
Novelty: 0.00073017
Score: 0.916
Data Source: STRINGDB
GALM
Tbio
Family: Enzyme
Novelty: 0.01229792
Score: 0.915
Data Source: STRINGDB
HK1
Tchem
Family: Kinase
Novelty: 0.00089993
Score: 0.91
Data Source: STRINGDB
PGM1
Tbio
Family: Enzyme
Novelty: 0.00195415
Score: 0.901
Data Source: STRINGDB
GLB1
Tchem
Family: Enzyme
Novelty: 0.00274332
Score: 0.9
Data Source: STRINGDB
PGM2
Tbio
Family: Enzyme
Novelty: 0.01245335
Score: 0.9
Data Source: STRINGDB
HAX1
Tbio
Novelty: 0.00851075
Score: 0.898
Data Source: STRINGDB
HK3
Tbio
Family: Kinase
Novelty: 0.02597641
Score: 0.855
Data Source: STRINGDB
Publication Statistics
PubMed Score  40.25

PubMed score by year
PubTator Score  85.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLI
1-70
FKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSR
70-140
WVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVPMERELSFYGLTALALMLGT
140-210
SLIYWTLFTLGLDLSWSISLAFKWCERPEWIHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGN
210-280
GQKIACLVLAMGLLGPLDWLGHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS
280-346
MESTLGAGIVIAEALQNQLAWLENVWLWITFLGDPKILFLFYFPAAYYASRRVGIAVLWISLITEWLNLIFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVATRARSRWVRVMPSLAYCTFLLAVGLSRIFILAHFPHQVLAGLITGAVLGWLMTPRVPMERELSFYGLTALALMLGTSLIYWTLFTLGLDLSWSISLAFKWCERPEWIHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWLGHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS