You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FGF7
Fibroblast growth factor 7

Protein Summary
Description
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. Studies of mouse and rat homologs of this gene implicated roles in morphogenesis of epithelium, reepithelialization of wounds, hair development and early lung organogenesis. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267843
  • ENSP00000267843
  • ENSG00000140285
  • ENST00000560270
  • ENSP00000454205
  • ENST00000560765
  • ENSP00000453048
  • ENST00000614567
  • ENSP00000478148

Symbol
  • KGF
  • KGF
  • HBGF-7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.92
disease perturbation
0.87
biological term
0.82
virus perturbation
0.79
gene perturbation
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1591.61   (req: < 5)
Gene RIFs: 102   (req: <= 3)
Antibodies: 349   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1591.61   (req: >= 5)
Gene RIFs: 102   (req: > 3)
Antibodies: 349   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (66)
Activated point mutants of FGFR2 (R-HSA-2033519)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 39
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activated point mutants of FGFR2
Reactome
Constitutive Signaling by Aberrant PI3K in Cancer
Reactome
Cytokine Signaling in Immune system
Reactome
Disease
Reactome
Diseases of signal transduction
Name
Explore in Pharos
Explore in Source
Activated point mutants of FGFR2
Constitutive Signaling by Aberrant PI3K in Cancer
Cytokine Signaling in Immune system
Disease
Diseases of signal transduction
Gene Ontology Terms (32)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (178)
1 – 10 of 178
FGFR2
Tclin
Family: Kinase
Novelty: 0.00077461
Score: 0.993
Data Source: Reactome,STRINGDB
FGFBP1
Tbio
Novelty: 0.02453147
Score: 0.985
Data Source: Reactome,STRINGDB
FRS2
Tbio
Novelty: 0.00386363
Score: 0.947
Data Source: STRINGDB
MAPK3
Tchem
Family: Kinase
Novelty: 0.0001911
Score: 0.946
Data Source: STRINGDB
FGFR3
Tclin
Family: Kinase
Novelty: 0.00092116
Score: 0.942
Data Source: STRINGDB
HRAS
Tchem
Family: Enzyme
Novelty: 0.00008788
Score: 0.941
Data Source: STRINGDB
MAPK1
Tchem
Family: Kinase
Novelty: 0.00046573
Score: 0.937
Data Source: STRINGDB
FGFR1
Tclin
Family: Kinase
Novelty: 0.00068893
Score: 0.936
Data Source: STRINGDB
FGFBP2
Tbio
Novelty: 0.15734479
Score: 0.931
Data Source: STRINGDB
PTPN11
Tchem
Family: Enzyme
Novelty: 0.00086268
Score: 0.928
Data Source: STRINGDB
Publication Statistics
PubMed Score  1591.61

PubMed score by year
PubTator Score  558.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLF
1-70
CRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFK
70-140
ELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
140-194
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT