You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PELI2
E3 ubiquitin-protein ligase pellino homolog 2

Protein Summary
Description
E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates IL1B-induced IRAK1 'Lys-63'-linked polyubiquitination and possibly 'Lys-48'-linked ubiquitination. May be important for LPS- and IL1B-induced MAP3K7-dependent, but not MAP3K3-dependent, NF-kappa-B activation. Can activate the MAP (mitogen activated protein) kinase pathway leading to activation of ELK1.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000267460
  • ENSP00000267460
  • ENSG00000139946
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.8
PubMedID
0.72
microRNA
0.71
biological process
0.66
histone modification site profile
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.72   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 89   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.72   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 89   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (25)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 21
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
IRAK1 recruits IKK complex
Reactome
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
Reactome
Immune System
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
IRAK1 recruits IKK complex
IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation
Immune System
Innate Immune System
Protein-Protein Interactions (26)
1 – 10 of 26
IRAK1
Tchem
Family: Kinase
Novelty: 0.00254228
Score: 0.988
Data Source: Reactome,STRINGDB
IRAK4
Tchem
Family: Kinase
Novelty: 0.00479185
Score: 0.967
Data Source: Reactome,STRINGDB
TRAF6
Tbio
Novelty: 0.00159491
Score: 0.955
Data Source: Reactome,STRINGDB
CHUK
Tchem
Family: Kinase
Novelty: 0.00425902
Score: 0.919
Data Source: STRINGDB
IKBKB
Tchem
Family: Kinase
Novelty: 0.00107685
Score: 0.918
Data Source: STRINGDB
UBE2N
Tbio
Novelty: 0.00723255
Score: 0.911
Data Source: Reactome,STRINGDB
UBE2V1
Tbio
Novelty: 0.03062655
Score: 0.908
Data Source: Reactome,STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
Score: 0.908
Data Source: STRINGDB
PELI1
Tbio
Family: Enzyme
Novelty: 0.06987215
Score: 0.905
Data Source: Reactome,STRINGDB
PELI3
Tbio
Family: Enzyme
Novelty: 0.37037037
Score: 0.901
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  2.72

PubMed score by year
PubTator Score  3.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKA
1-70
ISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFA
70-140
CRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESQPGVWRE
140-210
ISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAA
210-280
RPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLG
280-350
CEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID
350-420
MFSPGQEEHCAPNKEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVISTPQASKAISCKGQHSISYTLSRNQTVVVEYTHDKDTDMFQVGRSTESPIDFVVTDTISGSQNTDEAQITQSTISRFACRIVCDRNEPYTARIFAAGFDSSKNIFLGEKAAKWKNPDGHMDGLTTNGVLVMHPRGGFTEESQPGVWREISVCGDVYTLRETRSAQQRGKLVESETNVLQDGSLIDLCGATLLWRTADGLFHTPTQKHIEALRQEINAARPQCPVGLNTLAFPSINRKEVVEEKQPWAYLSCGHVHGYHNWGHRSDTEANERECPMCRTVGPYVPLWLGCEAGFYVDAGPPTHAFTPCGHVCSEKSAKYWSQIPLPHGTHAFHAACPFCATQLVGEQNCIKLIFQGPID