You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MARCH9
E3 ubiquitin-protein ligase MARCH9

Protein Summary
Description
E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I, CD4 and ICAM1, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. MARCH9 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH9 induces internalization of several membrane glycoproteins and directs them to the endosomal compartment (Bartee et al., 2004 [PubMed 14722266]; Hoer et al., 2007 [PubMed 17174307]).[supplied by OMIM, Apr 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000266643
  • ENSP00000266643
  • ENSG00000139266
  • ENST00000548358
  • ENSP00000446758

Symbol
  • RNF179
  • RNF179
  • MARCH-IX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.69
cell line
0.55
cell type or tissue
0.55
tissue sample
0.55
microRNA
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.94   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 149   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.94   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 149   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (1)
Items per page:
1 – 1 of 1
Data Source
Name
Explore in Pharos
Explore in Source
UniProt
Protein modification; protein ubiquitination.
Name
Explore in Pharos
Explore in Source
Protein modification; protein ubiquitination.
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (31)
1 – 10 of 31
POTEI
Tdark
Novelty: 0.30601093
p_int: 0.999858742
p_ni: 0.000141257
Score: 0.205
Data Source: BioPlex,STRINGDB
ATG9A
Tbio
Novelty: 0.02725439
p_int: 0.795488221
p_ni: 0.204452891
p_wrong: 0.000058889
Score: 0.187
Data Source: BioPlex,STRINGDB
UBE2H
Tbio
Novelty: 0.05325157
Score: 0.722
Data Source: STRINGDB
AP1M1
Tbio
Novelty: 0.05716619
Score: 0.673
Data Source: STRINGDB
MARCH10
Tbio
Family: Enzyme
Novelty: 0.09756098
Score: 0.672
Data Source: STRINGDB
UBE2E1
Tbio
Novelty: 0.05570885
Score: 0.648
Data Source: STRINGDB
IFFO1
Tdark
Novelty: 0.63157895
Score: 0.577
Data Source: STRINGDB
RNF44
Tdark
Novelty: 6
Score: 0.576
Data Source: STRINGDB
DCST1
Tdark
Novelty: 0.63157895
Score: 0.576
Data Source: STRINGDB
CDC34
Tbio
Novelty: 0.0081338
Score: 0.539
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.94

PubMed score by year
PubTator Score  155.42

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAG
1-70
DKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCL
70-140
IRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPS
140-210
AKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAG
210-280
KSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
280-346
MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAGDKEPRAGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSWSCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYGMYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV