You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FBXO7
F-box only protein 7

Protein Summary
Description
Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes BIRC2 and DLGAP5. Plays a role downstream of PINK1 in the clearance of damaged mitochondria via selective autophagy (mitophagy) by targeting PRKN to dysfunctional depolarized mitochondria. Promotes MFN1 ubiquitination. This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000266087
  • ENSP00000266087
  • ENSG00000100225
  • ENST00000397426
  • ENSP00000380571
  • ENST00000452138
  • ENSP00000388547

Symbol
  • FBX7
  • FBX
  • FBX7
  • PKPS
  • FBX07
  • PARK15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
1
disease perturbation
0.99
virus perturbation
0.99
biological process
0.9
cell type or tissue
0.81


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 133.41   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 149   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 133.41   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 149   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen processing: Ubiquitination & Proteasome degradation
Reactome
Class I MHC mediated antigen processing & presentation
Reactome
Immune System
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen processing: Ubiquitination & Proteasome degradation
Class I MHC mediated antigen processing & presentation
Immune System
Metabolism of proteins
Gene Ontology Terms (32)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Experiment (EXP)
Reactome
Inferred from Direct Assay (IDA)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Protein-Protein Interactions (408)
1 – 10 of 408
PSMF1
Tbio
Novelty: 0.04817066
p_int: 0.999998883
p_ni: 0.00000111
p_wrong: 7e-9
Score: 0.889
Data Source: BioPlex,STRINGDB
PSMG2
Tbio
Novelty: 0.07196402
p_int: 0.99986863
p_ni: 0.00013137
Score: 0.775
Data Source: BioPlex,STRINGDB
PSMB7
Tbio
Family: Enzyme
Novelty: 0.13674668
p_int: 0.999806468
p_ni: 0.000193532
Score: 0.584
Data Source: BioPlex,STRINGDB
PSMB4
Tbio
Family: Enzyme
Novelty: 0.06608783
p_int: 0.999621296
p_ni: 0.000378704
Score: 0.787
Data Source: BioPlex,STRINGDB
RNF181
Tbio
Family: Enzyme
Novelty: 0.33426184
p_int: 0.999591552
p_ni: 0.000408365
p_wrong: 8.3e-8
Score: 0.666
Data Source: BioPlex,STRINGDB
CUL1
Tbio
Novelty: 0.00339576
p_int: 0.998876399
p_ni: 0.001123601
Score: 0.974
Data Source: BioPlex,STRINGDB
PSMB2
Tclin
Family: Enzyme
Novelty: 0.15790562
p_int: 0.998823899
p_ni: 0.001176101
Score: 0.787
Data Source: BioPlex,STRINGDB
PSMA5
Tbio
Family: Enzyme
Novelty: 0.05889678
p_int: 0.998389918
p_ni: 0.00160912
p_wrong: 9.62e-7
Data Source: BioPlex
YAF2
Tbio
Novelty: 0.14775726
p_int: 0.99805542
p_ni: 0.001944296
p_wrong: 2.84e-7
Data Source: BioPlex
FBXW2
Tbio
Novelty: 0.00647177
p_int: 0.996836236
p_ni: 0.000534718
p_wrong: 0.002629046
Score: 0.932
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  133.41

PubMed score by year
PubTator Score  46.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVS
1-70
GDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSML
70-140
GPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLES
140-210
GYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLL
210-280
PESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVR
280-350
SVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTH
350-420
TIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPG
420-490
PNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM
490-522
MRLRVRLLKRTWPLEVPETEPTLGHLRSHLRQSLLCTWGYSSNTRFTITLNYKDPLTGDEETLASYGIVSGDLICLILQDDIPAPNIPSSTDSEHSSLQNNEQPSLATSSNQTSMQDEQPSDSFQGQAAQSGVWNDDSMLGPSQNFEAESIQDNAHMAEGTGFYPSEPMLCSESVEGQVPHSLETLYQSADCSDANDALIVLIHLLMLESGYIPQGTEAKALSMPEKWKLSGVYKLQYMHPLCEGSSATLTCVPLGNLIVVNATLKINNEIRSVKRLQLLPESFICKEKLGENVANIYKDLQKLSRLFKDQLVYPLLAFTRQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLPYVGDPISSLIPGPGETPSQFPPLRPRFDPVGPLPGPNPILPGRGGPNDRFPFRPSRGRPTDGRLSFM