You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GAL
Galanin peptides

Protein Summary
Description
Endocrine hormone of the central and peripheral nervous systems that binds and activates the G protein-coupled receptors GALR1, GALR2, and GALR3. This small neuropeptide may regulate diverse physiologic functions including contraction of smooth muscle of the gastrointestinal and genitourinary tract, growth hormone and insulin release and adrenal secretion. This gene encodes a neuroendocrine peptide that is widely expressed in the central and peripheral nervous systems and also the gastrointestinal tract, pancreas, adrenal gland and urogenital tract. The encoded protein is a precursor that is proteolytically processed to generate two mature peptides: galanin and galanin message-associated peptide (GMAP). Galanin has diverse physiological functions including nociception, feeding and energy homeostasis, osmotic regulation and water balance. GMAP has been demonstrated to possess antifungal activity and hypothesized to be part of the innate immune system. [provided by RefSeq, Jul 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265643
  • ENSP00000265643
  • ENSG00000069482

Symbol
  • GAL1
  • GALN
  • GLNN
  • ETL8
  • GALN
  • GLNN
  • GMAP
  • GAL-GMAP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.99
gene perturbation
0.99
transcription factor perturbation
0.74
small molecule perturbation
0.73
disease
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2193.57   (req: < 5)
Gene RIFs: 70   (req: <= 3)
Antibodies: 355   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2193.57   (req: >= 5)
Gene RIFs: 70   (req: > 3)
Antibodies: 355   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 25
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Class A/1 (Rhodopsin-like receptors) (R-HSA-373076)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class A/1 (Rhodopsin-like receptors)
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
GPCR ligand binding
Reactome
Peptide ligand-binding receptors
Name
Explore in Pharos
Explore in Source
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
GPCR downstream signalling
GPCR ligand binding
Peptide ligand-binding receptors
Protein-Protein Interactions (319)
1 – 10 of 319
MGAT4C
Tbio
Family: Enzyme
Novelty: 0.0221593
p_int: 0.999985192
p_ni: 0.000002145
p_wrong: 0.000012664
Score: 0.272
Data Source: BioPlex,STRINGDB
MMP10
Tchem
Novelty: 0.00168502
p_int: 0.999916822
p_ni: 0.000079412
p_wrong: 0.000003766
Score: 0.187
Data Source: BioPlex,STRINGDB
FCGRT
Tchem
Novelty: 0.0014463
p_int: 0.999271637
p_ni: 0.0006478
p_wrong: 0.000080563
Data Source: BioPlex
B3GALT5
Tbio
Family: Enzyme
Novelty: 0.05431281
p_int: 0.99594704
p_ni: 0.004039696
p_wrong: 0.000013264
Data Source: BioPlex
MICB
Tbio
Novelty: 0.00776922
p_int: 0.988477118
p_ni: 0.010137433
p_wrong: 0.001385449
Data Source: BioPlex
HSPA5
Tchem
Novelty: 0.00051387
p_int: 0.982334773
p_ni: 0.017665227
Data Source: BioPlex
CEACAM21
Tdark
Novelty: 0.98765432
p_int: 0.979796304
p_ni: 0.00006454
p_wrong: 0.020139156
Score: 0.179
Data Source: BioPlex,STRINGDB
HLA-DPA1
Tbio
Novelty: 0.01432663
p_int: 0.960917724
p_ni: 0.000077436
p_wrong: 0.03900484
Data Source: BioPlex
CSTL1
Tdark
Novelty: 0.27027027
p_int: 0.912933354
p_ni: 0.034807198
p_wrong: 0.052259448
Data Source: BioPlex
ZMYND19
Tdark
Novelty: 0.42857143
p_int: 0.877668581
p_ni: 0.122322214
p_wrong: 0.000009204
Data Source: BioPlex
Publication Statistics
PubMed Score  2193.57

PubMed score by year
PubTator Score  202.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPED
1-70
DMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
70-123
MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS