You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
SLC9A3
Sodium/hydrogen exchanger 3

Protein Summary
Description
Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient (PubMed:26358773). Plays an important role in signal transduction. The protein encoded by this gene is an epithelial brush border Na/H exchanger that uses an inward sodium ion gradient to expel acids from the cell. Defects in this gene are a cause of congenital secretory sodium diarrhea. Pseudogenes of this gene exist on chromosomes 10 and 22. [provided by RefSeq, Mar 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264938
  • ENSP00000264938
  • ENSG00000066230
  • ENST00000514375
  • ENSP00000422983

Symbol
  • NHE3
  • NHE3
  • DIAR8
  • NHE-3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.81
biological term
0.75
cell line
0.61
cellular component
0.61
disease
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 645.78   (req: < 5)
Gene RIFs: 69   (req: <= 3)
Antibodies: 284   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 645.78   (req: >= 5)
Gene RIFs: 69   (req: > 3)
Antibodies: 284   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 205
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Approved Drugs (2)
1 – 2 of 2
amiloride
chemical structure image
tenapanor
chemical structure image
Active Ligands (205)
1 – 10 of 205
CHEMBL3897683
chemical structure image
CHEMBL3926192
chemical structure image
CHEMBL3979206
chemical structure image
CHEMBL3987020
chemical structure image
CHEMBL3964543
chemical structure image
CHEMBL3979252
chemical structure image
CHEMBL3897301
chemical structure image
CHEMBL3897976
chemical structure image
CHEMBL3908997
chemical structure image
CHEMBL3916168
chemical structure image
Pathways (59)
SLC-mediated transmembrane transport (R-HSA-425407)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
SLC-mediated transmembrane transport
Reactome
Sodium/Proton exchangers
Reactome
Transport of inorganic cations/anions and amino acids/oligopeptides
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
SLC-mediated transmembrane transport
Sodium/Proton exchangers
Transport of inorganic cations/anions and amino acids/oligopeptides
Transport of small molecules
Protein-Protein Interactions (139)
1 – 10 of 139
EDN1
Tbio
Novelty: 0.000085
Score: 0.959
Data Source: STRINGDB
EDNRB
Tclin
Family: GPCR
Novelty: 0.00055047
Score: 0.929
Data Source: STRINGDB
SLC9A3R2
Tbio
Family: Transporter
Novelty: 0.01296563
Score: 0.923
Data Source: STRINGDB
SLC9A3R1
Tbio
Family: Transporter
Novelty: 0.0026167
Score: 0.921
Data Source: STRINGDB
ROCK1
Tclin
Family: Kinase
Novelty: 0.00196146
Score: 0.915
Data Source: STRINGDB
CHP1
Tbio
Novelty: 0.02100823
Score: 0.912
Data Source: STRINGDB
ROCK2
Tclin
Family: Kinase
Novelty: 0.00286446
Score: 0.907
Data Source: STRINGDB
PDZK1
Tbio
Novelty: 0.01289625
Score: 0.876
Data Source: STRINGDB
LRP2
Tbio
Novelty: 0.002005
Score: 0.856
Data Source: STRINGDB
SLC12A1
Tclin
Family: Transporter
Novelty: 0.00394411
Score: 0.845
Data Source: STRINGDB
Publication Statistics
PubMed Score  645.78

PubMed score by year
PubTator Score  314.81

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MWGLGARGPDRGLLLALALGGLARAGGVEVEPGGAHGESGGFQVVTFEWAHVQDPYVIALWILVASLAKI
1-70
GFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNL
70-140
GTILLYAVVGTVWNAATTGLSLYGVFLSGLMGDLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLF
140-210
IIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTK
210-280
HVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETII
280-350
FMFLGISAVNPFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVLSYGGLRGAVAF
350-420
ALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLHGRAFDHILSA
420-490
IEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNLKDAISYVAEGERRGSLAFIR
490-560
SPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQE
560-630
YKHLYSRHELTPTEDEKQDREIFHRTMRKRLESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLP
630-700
MESPAQNFTIKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLAR
700-770
LPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM
770-834
MWGLGARGPDRGLLLALALGGLARAGGVEVEPGGAHGESGGFQVVTFEWAHVQDPYVIALWILVASLAKIGFHLSHKVTSVVPESALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMGDLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVNPFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMVQLEPIDQVVLSYGGLRGAVAFALVVLLDGDKVKEKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNLKDAISYVAEGERRGSLAFIRSPSTDNVVNVDFTPRSSTVEASVSYLLRENVSAVCLDMQSLEQRRRSIRDAEDMVTHHTLQQYLYKPRQEYKHLYSRHELTPTEDEKQDREIFHRTMRKRLESFKSTKLGLNQNKKAAKLYKRERAQKRRNSSIPNGKLPMESPAQNFTIKEKDLELSDTEEPPNYDEEMSGGIEFLASVTKDTASDSPAGIDNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQIPYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPESTHM