You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ARSB
Arylsulfatase B

Protein Summary
Description
Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation (PubMed:19306108). Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium (PubMed:19306108). In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels (By similarity). Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264914
  • ENSP00000264914
  • ENSG00000113273
  • ENST00000396151
  • ENSP00000379455

Symbol
  • ASB
  • G4S
  • MPS6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
1
biological process
0.84
small molecule perturbation
0.83
cellular component
0.8
transcription factor binding site profile
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 299.81   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 281   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 299.81   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 281   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (24)
CS/DS degradation (R-HSA-2024101)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 20
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
CS/DS degradation
Reactome
Chondroitin sulfate/dermatan sulfate metabolism
Reactome
Disease
Reactome
Diseases of carbohydrate metabolism
Reactome
Diseases of metabolism
Name
Explore in Pharos
Explore in Source
CS/DS degradation
Chondroitin sulfate/dermatan sulfate metabolism
Disease
Diseases of carbohydrate metabolism
Diseases of metabolism
Protein-Protein Interactions (144)
1 – 10 of 144
ERP29
Tbio
Novelty: 0.01607061
p_int: 0.999677985
p_ni: 0.000321886
p_wrong: 1.3e-7
Score: 0.273
Data Source: BioPlex,STRINGDB
DEFA1
Tbio
Novelty: 0.01616437
p_int: 0.999433313
p_ni: 0.000566407
p_wrong: 2.8e-7
Data Source: BioPlex
PTPRK
Tbio
Family: Enzyme
Novelty: 0.03472453
p_int: 0.999390122
p_ni: 0.000602194
p_wrong: 0.000007684
Score: 0.161
Data Source: BioPlex,STRINGDB
INSL5
Tbio
Novelty: 0.03673832
p_int: 0.998911531
p_ni: 0.001088434
p_wrong: 3.5e-8
Data Source: BioPlex
NAAA
Tchem
Family: Enzyme
Novelty: 0.00198736
p_int: 0.994824816
p_ni: 0.005006623
p_wrong: 0.000168561
Score: 0.271
Data Source: BioPlex,STRINGDB
PLAUR
Tchem
Family: Enzyme
Novelty: 0.00096649
p_int: 0.994295415
p_ni: 0.005680963
p_wrong: 0.000023621
Data Source: BioPlex
LCN6
Tbio
Novelty: 0.06664903
p_int: 0.992782279
p_ni: 0.007027482
p_wrong: 0.000190239
Data Source: BioPlex
RLN1
Tbio
Novelty: 0.05712331
p_int: 0.992150279
p_ni: 0.007251418
p_wrong: 0.000598303
Data Source: BioPlex
AVP
Tbio
Novelty: 0.0001163
p_int: 0.991530233
p_ni: 0.008415469
p_wrong: 0.000054297
Score: 0.181
Data Source: BioPlex,STRINGDB
SIAE
Tbio
Family: Enzyme
Novelty: 0.00505798
p_int: 0.97764758
p_ni: 0.022267184
p_wrong: 0.000085236
Score: 0.622
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  299.81

PubMed score by year
PubTator Score  401.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP
1-70
HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT
70-140
HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY
140-210
STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV
210-280
TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI
280-350
SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
350-420
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE
420-490
YPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
490-533
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM