You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MXD1
Max dimerization protein 1

Protein Summary
Description
Transcriptional repressor. MAD binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. MAD thus antagonizes MYC transcriptional activity by competing for MAX. This gene encodes a member of the MYC/MAX/MAD network of basic helix-loop-helix leucine zipper transcription factors. The MYC/MAX/MAD transcription factors mediate cellular proliferation, differentiation and apoptosis. The encoded protein antagonizes MYC-mediated transcriptional activation of target genes by competing for the binding partner MAX and recruiting repressor complexes containing histone deacetylases. Mutations in this gene may play a role in acute leukemia, and the encoded protein is a potential tumor suppressor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000264444
  • ENSP00000264444
  • ENSG00000059728
  • ENST00000540449
  • ENSP00000443935

Symbol
  • MAD
  • MAD
  • MAD1
  • BHLHC58
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
molecular function
0.9
transcription factor binding site profile
0.81
transcription factor perturbation
0.8
histone modification site profile
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.52   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 171   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.52   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 171   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
PathwayCommons: pid
Signaling events mediated by HDAC Class I
PathwayCommons: pid
Regulation of Telomerase
Name
Explore in Pharos
Explore in Source
Signaling events mediated by HDAC Class I
Regulation of Telomerase
Gene Ontology Terms (15)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (56)
1 – 10 of 56
ARID4B
Tbio
Family: TF; Epigenetic
Novelty: 0.05116399
p_int: 0.999713672
p_ni: 0.000286328
Score: 0.201
Data Source: BioPlex,STRINGDB
SAP130
Tdark
Family: Enzyme
p_int: 0.999055064
p_ni: 0.000944936
Score: 0.285
Data Source: BioPlex,STRINGDB
SUDS3
Tbio
Family: Enzyme
Novelty: 0.02419541
p_int: 0.998273434
p_ni: 0.001726566
Score: 0.711
Data Source: BioPlex,STRINGDB
MAX
Tbio
Family: TF
Novelty: 0.00681918
p_int: 0.996824091
p_ni: 0.00317578
p_wrong: 1.3e-7
Score: 0.993
Data Source: BioPlex,STRINGDB
SIN3A
Tbio
Novelty: 0.01059111
p_int: 0.994806205
p_ni: 0.005191593
p_wrong: 0.000002201
Score: 0.998
Data Source: BioPlex,STRINGDB
BRMS1
Tbio
Novelty: 0.01896458
p_int: 0.983869019
p_ni: 0.015204242
p_wrong: 0.000926738
Score: 0.226
Data Source: BioPlex,STRINGDB
ARID4A
Tbio
Family: TF; Epigenetic
Novelty: 0.036284
p_int: 0.971564829
p_ni: 0.028435171
Score: 0.28
Data Source: BioPlex,STRINGDB
BRMS1L
Tbio
Novelty: 0.01751546
p_int: 0.969876479
p_ni: 0.030123521
Score: 0.226
Data Source: BioPlex,STRINGDB
SAP30L
Tbio
Family: Enzyme
Novelty: 0.21724952
p_int: 0.904089858
p_ni: 0.00012218
p_wrong: 0.095787962
Score: 0.28
Data Source: BioPlex,STRINGDB
SIN3B
Tbio
Novelty: 0.04173216
Score: 0.987
Data Source: STRINGDB
Publication Statistics
PubMed Score  16.52

PubMed score by year
PubTator Score  155.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRA
1-70
HLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIER
70-140
IRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIK
140-210
LQDSHKACLGL
210-221
MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL