You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IL7
Interleukin-7

Protein Classes
Protein Summary
Description
Hematopoietic growth factor capable of stimulating the proliferation of lymphoid progenitors. It is important for proliferation during certain stages of B-cell maturation. The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their presence in normal tissues has not been confirmed.[provided ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263851
  • ENSP00000263851
  • ENSG00000104432
  • ENST00000520269
  • ENSP00000427750

Symbol
  • IL-7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.97
co-expressed gene
0.91
biological process
0.79
phenotype
0.73
histone modification site profile
0.71


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1262.01   (req: < 5)
Gene RIFs: 197   (req: <= 3)
Antibodies: 688   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1262.01   (req: >= 5)
Gene RIFs: 197   (req: > 3)
Antibodies: 688   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
Interleukin-7 signaling
Reactome
Signaling by Interleukins
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
Interleukin-7 signaling
Signaling by Interleukins
Gene Ontology Terms (24)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (331)
1 – 10 of 331
ATF6B
Tbio
Family: TF
Novelty: 0.09074217
p_int: 0.997115683
p_ni: 0.002884317
Data Source: BioPlex
ZMPSTE24
Tbio
Family: Enzyme
Novelty: 0.00353005
p_int: 0.995721301
p_ni: 0.004275188
p_wrong: 0.000003511
Data Source: BioPlex
ATF6
Tbio
Family: TF
Novelty: 0.00214036
p_int: 0.994302625
p_ni: 0.005697375
Data Source: BioPlex
QKI
Tbio
Novelty: 0.0126798
p_int: 0.978253125
p_ni: 0.021746418
p_wrong: 4.57e-7
Data Source: BioPlex
NOTCH3
Tchem
Novelty: 0.00119412
p_int: 0.89579064
p_ni: 0.053683307
p_wrong: 0.050526053
Score: 0.209
Data Source: BioPlex,STRINGDB
FGFR1
Tclin
Family: Kinase
Novelty: 0.00068893
p_int: 0.770937484
p_ni: 0.229061958
p_wrong: 5.58e-7
Score: 0.185
Data Source: BioPlex,STRINGDB
ADAM10
Tchem
Family: Enzyme
Novelty: 0.00205189
p_int: 0.757351096
p_ni: 0.242648899
p_wrong: 5e-9
Data Source: BioPlex
IL7R
Tbio
Novelty: 0.00182378
Score: 0.998
Data Source: Reactome,STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.985
Data Source: Reactome,STRINGDB
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
Score: 0.984
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  1262.01

PubMed score by year
PubTator Score  989.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRH
1-70
ICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEE
70-140
NKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
140-177
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH