You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EPCAM
Epithelial cell adhesion molecule

Protein Summary
Description
May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263735
  • ENSP00000263735
  • ENSG00000119888

Symbol
  • GA733-2
  • M1S2
  • M4S1
  • MIC18
  • TACSTD1
  • TROP1
  • ESA
  • KSA
  • M4S1
  • MK-1
  • DIAR5
  • EGP-2
  • EGP40
  • KS1/4
  • MIC18
  • TROP1
  • EGP314
  • HNPCC8
  • TACSTD1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.95
transcription factor perturbation
0.84
PubMedID
0.68
gene perturbation
0.67
disease
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1766.89   (req: < 5)
Gene RIFs: 250   (req: <= 3)
Antibodies: 4043   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1766.89   (req: >= 5)
Gene RIFs: 250   (req: > 3)
Antibodies: 4043   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (2)
Cell surface interactions at the vascular wall (R-HSA-202733)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 2 of 2
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell surface interactions at the vascular wall
Reactome
Hemostasis
Name
Explore in Pharos
Explore in Source
Cell surface interactions at the vascular wall
Hemostasis
Protein-Protein Interactions (209)
1 – 10 of 209
CDH1
Tbio
Novelty: 0.0001303
Score: 0.941
Data Source: STRINGDB
CLDN7
Tbio
Novelty: 0.00860191
Score: 0.936
Data Source: STRINGDB
KRT19
Tbio
Novelty: 0.00055202
Score: 0.903
Data Source: STRINGDB
CD44
Tbio
Novelty: 0.00013754
Score: 0.876
Data Source: STRINGDB
PROM1
Tbio
Novelty: 0.00045556
Score: 0.835
Data Source: STRINGDB
CD24
Tbio
Novelty: 0.00137036
Score: 0.834
Data Source: STRINGDB
PTPRC
Tchem
Family: Enzyme
Novelty: 0.00019614
Score: 0.81
Data Source: STRINGDB
KRT8
Tbio
Novelty: 0.00128652
Score: 0.807
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.799
Data Source: STRINGDB
KRT18
Tbio
Novelty: 0.00086008
Score: 0.779
Data Source: STRINGDB
Publication Statistics
PubMed Score  1766.89

PubMed score by year
PubTator Score  1295.78

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK
1-70
AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVR
70-140
TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA
140-210
DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV
210-280
AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
280-314
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA