You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SYP
Synaptophysin

Protein Summary
Description
Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity (By similarity). This gene encodes an integral membrane protein of small synaptic vesicles in brain and endocrine cells. The protein also binds cholesterol and is thought to direct targeting of vesicle-associated membrane protein 2 (synaptobrevin) to intracellular compartments. Mutations in this gene are associated with an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263233
  • ENSP00000263233
  • ENSG00000102003
  • ENST00000479808
  • ENSP00000418169

Symbol
  • MRX96
  • MRXSYP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cellular component
0.78
chemical
0.74
kinase
0.72
cell type or tissue
0.7
molecular function
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2955.12   (req: < 5)
Gene RIFs: 44   (req: <= 3)
Antibodies: 1128   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2955.12   (req: >= 5)
Gene RIFs: 44   (req: > 3)
Antibodies: 1128   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
Synaptic Vesicle Pathway
WikiPathways
Synaptic Vesicle Pathway
WikiPathways
Insulin Signaling
Name
Explore in Pharos
Explore in Source
Synaptic Vesicle Pathway
Synaptic Vesicle Pathway
Insulin Signaling
Protein-Protein Interactions (362)
1 – 10 of 362
TMEM183A
Tdark
Novelty: 0.70391061
p_int: 0.999895254
p_ni: 0.000099867
p_wrong: 0.000004878
Score: 0.319
Data Source: BioPlex,STRINGDB
PTS
Tbio
Family: Enzyme
Novelty: 0.00144771
p_int: 0.999790986
p_ni: 0.000003907
p_wrong: 0.000205106
Score: 0.203
Data Source: BioPlex,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.999497035
p_ni: 0.000196789
p_wrong: 0.000306176
Data Source: BioPlex
DGUOK
Tbio
Family: Kinase
Novelty: 0.00695477
p_int: 0.999497035
p_ni: 0.000196789
p_wrong: 0.000306176
Data Source: BioPlex
SLC25A23
Tbio
Family: Transporter
Novelty: 0.2047077
p_int: 0.999055555
p_ni: 0.000944312
p_wrong: 1.33e-7
Score: 0.156
Data Source: BioPlex,STRINGDB
MRS2
Tbio
Novelty: 0.00265329
p_int: 0.997940383
p_ni: 0.002059617
Data Source: BioPlex
SLC35B2
Tbio
Family: Transporter
Novelty: 0.00442602
p_int: 0.991311263
p_ni: 0.008678446
p_wrong: 0.000010291
Score: 0.167
Data Source: BioPlex,STRINGDB
SFXN3
Tdark
Novelty: 0.24
p_int: 0.987916718
p_ni: 0.006530752
p_wrong: 0.00555253
Score: 0.161
Data Source: BioPlex,STRINGDB
SLC20A2
Tbio
Family: Transporter
Novelty: 0.00538275
p_int: 0.985182401
p_ni: 0.009305476
p_wrong: 0.005512123
Data Source: BioPlex
SLC25A16
Tbio
Family: Transporter
Novelty: 0.00123354
p_int: 0.984187348
p_ni: 0.015812652
Score: 0.157
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  2955.12

PubMed score by year
PubTator Score  1808.72

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVE
1-70
FEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPM
70-140
LDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFL
140-210
NLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQ
210-280
PAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM
280-313
MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM