You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DGCR8
Microprocessor complex subunit DGCR8

Protein Summary
Description
Component of the microprocessor complex that acts as a RNA- and heme-binding protein that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus. Within the microprocessor complex, DGCR8 function as a molecular anchor necessary for the recognition of pri-miRNA at dsRNA-ssRNA junction and directs DROSHA to cleave 11 bp away form the junction to release hairpin-shaped pre-miRNAs that are subsequently cut by the cytoplasmic DICER to generate mature miRNAs (PubMed:26027739, PubMed:26748718). The heme-bound DGCR8 dimer binds pri-miRNAs as a cooperative trimer (of dimers) and is active in triggering pri-miRNA cleavage, whereas the heme-free DGCR8 monomer binds pri-miRNAs as a dimer and is much less active. Both double-stranded and single-stranded regions of a pri-miRNA are required for its binding (PubMed:15531877, PubMed:15 ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000351989
  • ENSP00000263209
  • ENSG00000128191
  • ENST00000383024
  • ENSP00000372488
  • ENST00000407755
  • ENSP00000384726

Symbol
  • C22orf12
  • DGCRK6
  • Gy1
  • pasha
  • DGCRK6
  • C22orf12
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
kinase perturbation
0.88
transcription factor perturbation
0.8
small molecule perturbation
0.77
cellular component
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 301.1   (req: < 5)
Gene RIFs: 55   (req: <= 3)
Antibodies: 291   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 301.1   (req: >= 5)
Gene RIFs: 55   (req: > 3)
Antibodies: 291   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (4)
1 – 4 of 4
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (11)
Gene Silencing by RNA (R-HSA-211000)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene Silencing by RNA
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
MicroRNA (miRNA) biogenesis
Reactome
RNA Polymerase II Transcription
Name
Explore in Pharos
Explore in Source
Gene Silencing by RNA
Gene expression (Transcription)
Generic Transcription Pathway
MicroRNA (miRNA) biogenesis
RNA Polymerase II Transcription
Gene Ontology Terms (13)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (196)
1 – 10 of 196
DROSHA
Tbio
Family: Enzyme
Novelty: 0.0023259
p_int: 0.999999981
p_ni: 1.9e-8
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ERH
Tbio
Novelty: 0.00493543
p_int: 0.999999799
p_ni: 2.01e-7
Score: 0.234
Data Source: BioPlex,STRINGDB
RRP8
Tbio
Family: Enzyme
Novelty: 0.00456854
p_int: 0.999963337
p_ni: 0.000036663
Score: 0.219
Data Source: BioPlex,STRINGDB
ZNF7
Tdark
Family: TF
Novelty: 0.27126391
p_int: 0.999681086
p_ni: 0.000318914
Data Source: BioPlex
PABPC4L
Tdark
Novelty: 1
p_int: 0.999551498
p_ni: 0.000447388
p_wrong: 0.000001114
Data Source: BioPlex
CENPI
Tbio
Novelty: 0.02317689
p_int: 0.999246709
p_ni: 0.000753287
p_wrong: 4e-9
Score: 0.313
Data Source: BioPlex,STRINGDB
ITGB3BP
Tbio
Novelty: 0.08545938
p_int: 0.998546249
p_ni: 0.000776552
p_wrong: 0.000677199
Score: 0.538
Data Source: BioPlex,STRINGDB
CENPO
Tbio
Novelty: 0.21171789
p_int: 0.996210912
p_ni: 0.003688207
p_wrong: 0.000100881
Score: 0.305
Data Source: BioPlex,STRINGDB
SHQ1
Tbio
Novelty: 0.0779191
p_int: 0.99579658
p_ni: 0.004201944
p_wrong: 0.000001476
Score: 0.246
Data Source: BioPlex,STRINGDB
CENPC
Tbio
Novelty: 0.00808069
p_int: 0.995221834
p_ni: 0.004778163
p_wrong: 3e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  301.10

PubMed score by year
PubTator Score  173.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFY
1-70
GASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGA
70-140
ERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLE
140-210
LDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETS
210-280
VQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSI
280-350
PCLHYKKMKDNEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGAL
350-420
GQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLI
420-490
TLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASS
490-560
KKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKR
560-630
NHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGR
630-700
ESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCT
700-770
VDV
770-773
METDESPSPLPCGPAGEAVMESRARPFQALPREQSPPPPLQTSSGAEVMDVGSGGDGQSELPAEDPFNFYGASLLSKGSFSKGRLLIDPNCSGHSPRTARHAPAVRKFSPDLKLLKDVKISVSFTESCRSKDRKVLYTGAERDVRAECGLLLSPVSGDVHACPFGGSVGDGVGIGGESADKKDEENELDQEKRVEYAVLDELEDFTDNLELDEEGAGGFTAKAIVQRDRVDEEALNFPYEDDFDNDVDALLEEGLCAPKKRRTEEKYGGDSDHPSDGETSVQPMMTKIKTVLKSRGRPPTEPLPDGWIMTFHNSGVPVYLHRESRVVTWSRPYFLGTGSIRKHDPPLSSIPCLHYKKMKDNEEREQSSDLTPSGDVSPVKPLSRSAELEFPLDEPDSMGADPGPPDEKDPLGAEAAPGALGQVKAKVEVCKDESVDLEEFRSYLEKRFDFEQVTVKKFRTWAERRQFNREMKRKQAESERPILPANQKLITLSVQDAPTKKEFVINPNGKSEVCILHEYMQRVLKVRPVYNFFECENPSEPFGASVTIDGVTYGSGTASSKKLAKNKAARATLEILIPDFVKQTSEEKPKDSEELEYFNHISIEDSRVYELTSKAGLLSPYQILHECLKRNHGMGDTSIKFEVVPGKNQKSEYVMACGKHTVRGWCKNKRVGKQLASQKILQLLHPHVKNWGSLLRMYGRESSKMVKQETSDKSVIELQQYAKKNKPNLHILSKLQEEMKRLAEEREETRKKPKMSIVASAQPGGEPLCTVDV