You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
MAPK3
Mitogen-activated protein kinase 3

Protein Summary
Description
Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organel ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263025
  • ENSP00000263025
  • ENSG00000102882
  • ENST00000322266
  • ENSP00000327293
  • ENST00000395199
  • ENSP00000378625
  • ENST00000395202
  • ENSP00000378628

Symbol
  • ERK1
  • PRKM3
  • ERK1
  • ERT2
  • ERK-1
  • PRKM3
  • P44ERK1
  • P44MAPK
  • HS44KDAP
  • HUMKER1A
  • p44-ERK1
  • p44-MAPK
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
1
chemical
1
hub protein
1
interacting protein
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4046.17   (req: < 5)
Gene RIFs: 967   (req: <= 3)
Antibodies: 1997   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 4046.17   (req: >= 5)
Gene RIFs: 967   (req: > 3)
Antibodies: 1997   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 80
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 19
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
sorafenib
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (459)
Activation of NMDA receptors and postsynaptic events (R-HSA-442755)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 136
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of NMDA receptors and postsynaptic events
Reactome
Activation of the AP-1 family of transcription factors
Reactome
Advanced glycosylation endproduct receptor signaling
Reactome
Antiviral mechanism by IFN-stimulated genes
Reactome
Apoptosis
Name
Explore in Pharos
Explore in Source
Activation of NMDA receptors and postsynaptic events
Activation of the AP-1 family of transcription factors
Advanced glycosylation endproduct receptor signaling
Antiviral mechanism by IFN-stimulated genes
Apoptosis
Gene Ontology Terms (95)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (1162)
1 – 10 of 1162
ZDHHC11
Tdark
Family: Enzyme
Novelty: 0.38216561
p_int: 0.986668658
p_ni: 0.013331342
Score: 0.206
Data Source: BioPlex,STRINGDB
CPLX4
Tbio
Novelty: 0.06654783
p_int: 0.978478981
p_ni: 0.021521019
Score: 0.229
Data Source: BioPlex,STRINGDB
SPANXN4
Tdark
Novelty: 8
p_int: 0.963588317
p_ni: 0.036411683
Data Source: BioPlex
RNF181
Tbio
Family: Enzyme
Novelty: 0.33426184
p_int: 0.956767114
p_ni: 0.043232886
Data Source: BioPlex
UXS1
Tbio
Family: Enzyme
Novelty: 0.0861244
p_int: 0.950592351
p_ni: 0.049407649
Score: 0.172
Data Source: BioPlex,STRINGDB
SNRNP27
Tbio
Novelty: 0.00944493
p_int: 0.941105443
p_ni: 0.058894557
Data Source: BioPlex
NPTX2
Tbio
Novelty: 0.00419597
p_int: 0.936298848
p_ni: 0.063701152
Data Source: BioPlex
ECM1
Tbio
Novelty: 0.00696614
p_int: 0.916115183
p_ni: 0.083884817
Data Source: BioPlex
GPS2
Tbio
Novelty: 0.01793637
p_int: 0.903651996
p_ni: 0.096347982
p_wrong: 2.2e-8
Score: 0.255
Data Source: BioPlex,STRINGDB
CUEDC1
Tdark
Novelty: 0.26785714
p_int: 0.858982958
p_ni: 0.141017042
Data Source: BioPlex
Publication Statistics
PubMed Score  4046.17

PubMed score by year
PubTator Score  6793.44

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAI
1-70
KKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSN
70-140
DHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWY
140-210
RAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNY
210-280
LQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAM
280-350
ELDDLPKERLKELIFQETARFQPGVLEAP
350-379
MAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP