You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ATP4A
Potassium-transporting ATPase alpha chain 1

Protein Summary
Description
Catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. Responsible for acid production in the stomach. The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes a catalytic alpha subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262623
  • ENSP00000262623
  • ENSG00000105675

Symbol
  • ATP6A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
protein domain
1
disease perturbation
0.79
cell type or tissue
0.73
interacting protein
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6964.42   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 42   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6964.42   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 42   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 10
Approved Drugs (10)
1 – 10 of 10
lansoprazole
chemical structure image
dexrabeprazole
chemical structure image
ilaprazole
chemical structure image
vonoprazan
chemical structure image
omeprazole
chemical structure image
esomeprazole
chemical structure image
rabeprazole
chemical structure image
pantoprazole
chemical structure image
dexlansoprazole
chemical structure image
revaprazan
chemical structure image
Pathways (11)
Ion channel transport (R-HSA-983712)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Ion channel transport
Reactome
Ion transport by P-type ATPases
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Ion channel transport
Ion transport by P-type ATPases
Transport of small molecules
Protein-Protein Interactions (139)
1 – 10 of 139
KLK8
Tchem
Family: Enzyme
Novelty: 0.00379475
p_int: 0.999999194
p_ni: 8.05e-7
p_wrong: 1e-9
Score: 0.287
Data Source: BioPlex,STRINGDB
LIPC
Tchem
Family: Enzyme
Novelty: 0.00225617
p_int: 0.999995658
p_ni: 0.000004326
p_wrong: 1.5e-8
Score: 0.288
Data Source: BioPlex,STRINGDB
DNAAF2
Tbio
Novelty: 0.04657397
p_int: 0.999987326
p_ni: 0.000012659
p_wrong: 1.5e-8
Data Source: BioPlex
ERO1B
Tbio
Novelty: 0.10192488
p_int: 0.999983719
p_ni: 0.000005008
p_wrong: 0.000011273
Score: 0.191
Data Source: BioPlex,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.999905101
p_ni: 0.000094284
p_wrong: 6.15e-7
Data Source: BioPlex
ARMC1
Tbio
Novelty: 0.02013423
p_int: 0.99987368
p_ni: 0.000099414
p_wrong: 0.000026905
Data Source: BioPlex
HAX1
Tbio
Novelty: 0.00851075
p_int: 0.999863137
p_ni: 0.00002757
p_wrong: 0.000109294
Data Source: BioPlex
DGUOK
Tbio
Family: Kinase
Novelty: 0.00695477
p_int: 0.99977846
p_ni: 0.000105283
p_wrong: 0.000116258
Data Source: BioPlex
RRP7A
Tdark
Novelty: 0.28985507
p_int: 0.997348101
p_ni: 0.00263676
p_wrong: 0.000015139
Score: 0.185
Data Source: BioPlex,STRINGDB
CDCA8
Tbio
Novelty: 0.02218432
p_int: 0.994862657
p_ni: 0.000324726
p_wrong: 0.004812617
Score: 0.179
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  6964.42

PubMed score by year
PubTator Score  817.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSA
1-70
TKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDN
70-140
LYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRV
140-210
PADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGR
210-280
IASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLAT
280-350
VTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQ
350-420
TFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYRDRFPKVCE
420-490
IPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLG
490-560
ERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGD
560-630
HPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMV
630-700
FARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIV
700-770
TGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAES
770-840
DIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQ
840-910
DSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVCIGCFL
910-980
CYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY
980-1035
MGKAENYELYSVELGPGPGGDMAAKMSKKKKAGGGGGKRKEKLENMKKEMEINDHQLSVAELEQKYQTSATKGLSASLAAELLLRDGPNALRPPRGTPEYVKFARQLAGGLQCLMWVAAAICLIAFAIQASEGDLTTDDNLYLAIALIAVVVVTGCFGYYQEFKSTNIIASFKNLVPQQATVIRDGDKFQINADQLVVGDLVEMKGGDRVPADIRILAAQGCKVDNSSLTGESEPQTRSPECTHESPLETRNIAFFSTMCLEGTVQGLVVNTGDRTIIGRIASLASGVENEKTPIAIEIEHFVDIIAGLAILFGATFFIVAMCIGYTFLRAMVFFMAIVVAYVPEGLLATVTVCLSLTAKRLASKNCVVKNLEAVETLGSTSVICSDKTGTLTQNRMTVSHLWFDNHIHTADTTEDQSGQTFDQSSETWRALCRVLTLCNRAAFKSGQDAVPVPKRIVIGDASETALLKFSELTLGNAMGYRDRFPKVCEIPFNSTNKFQLSIHTLEDPRDPRHLLVMKGAPERVLERCSSILIKGQELPLDEQWREAFQTAYLSLGGLGERVLGFCQLYLNEKDYPPGYAFDVEAMNFPSSGLCFAGLVSMIDPPRATVPDAVLKCRTAGIRVIMVTGDHPITAKAIAASVGIISEGSETVEDIAARLRVPVDQVNRKDARACVINGMQLKDMDPSELVEALRTHPEMVFARTSPQQKLVIVESCQRLGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDAAKNAADMILLDDNFASIVTGVEQGRLIFDNLKKSIAYTLTKNIPELTPYLIYITVSVPLPLGCITILFIELCTDIFPSVSLAYEKAESDIMHLRPRNPKRDRLVNEPLAAYSYFQIGAIQSFAGFTDYFTAMAQEGWFPLLCVGLRAQWEDHHLQDLQDSYGQEWTFGQRLYQQYTCYTVFFISIEVCQIADVLIRKTRRLSAFQQGFFRNKILVIAIVFQVCIGCFLCYCPGMPNIFNFMPIRFQWWLVPLPYGILIFVYDEIRKLGVRCCPGSWWDQELYY