You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PITPNM3
Membrane-associated phosphatidylinositol transfer protein 3

Protein Summary
Description
Catalyzes the transfer of phosphatidylinositol and phosphatidylcholine between membranes (in vitro) (By similarity). Binds calcium ions. This gene encodes a member of a family of membrane-associated phosphatidylinositol transfer domain-containing proteins. The calcium-binding protein has phosphatidylinositol (PI) transfer activity and interacts with the protein tyrosine kinase PTK2B (also known as PYK2). The protein is homologous to a Drosophila protein that is implicated in the visual transduction pathway in flies. Mutations in this gene result in autosomal dominant cone dystrophy. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Sep 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262483
  • ENSP00000262483
  • ENSG00000091622
  • ENST00000421306
  • ENSP00000407882

Symbol
  • NIR1
  • NIR1
  • ACKR6
  • CORD5
  • RDGBA3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
metabolite
0.86
transcription factor perturbation
0.68
microRNA
0.61
protein domain
0.58
disease perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 33.08   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 116   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 33.08   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 116   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Glycerophospholipid biosynthesis (R-HSA-1483206)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Glycerophospholipid biosynthesis
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Phospholipid metabolism
Reactome
Synthesis of PI
Name
Explore in Pharos
Explore in Source
Glycerophospholipid biosynthesis
Metabolism
Metabolism of lipids
Phospholipid metabolism
Synthesis of PI
Protein-Protein Interactions (48)
1 – 10 of 48
VAPB
Tbio
Novelty: 0.00566042
p_int: 0.894901741
p_ni: 1.4e-8
p_wrong: 0.105098245
Score: 0.551
Data Source: BioPlex,STRINGDB
CCL18
Tbio
Novelty: 0.00534148
Score: 0.866
Data Source: STRINGDB
SGK494
Tdark
Family: Kinase
Novelty: 2.21635884
Score: 0.735
Data Source: STRINGDB
TMIGD1
Tdark
Novelty: 0.22857143
Score: 0.704
Data Source: STRINGDB
PTK2B
Tclin
Family: Kinase
Novelty: 0.0009627
Score: 0.698
Data Source: STRINGDB
DPH1
Tbio
Novelty: 0.02897945
Score: 0.696
Data Source: STRINGDB
MRM3
Tbio
Family: Enzyme
Novelty: 0.11111111
Score: 0.691
Data Source: STRINGDB
MED31
Tbio
Family: Enzyme
Novelty: 0.0541425
Score: 0.677
Data Source: STRINGDB
RIMS1
Tbio
Novelty: 0.01015452
Score: 0.675
Data Source: STRINGDB
KIAA0753
Tdark
Novelty: 0.00390916
Score: 0.668
Data Source: STRINGDB
Publication Statistics
PubMed Score  33.08

PubMed score by year
PubTator Score  18.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAKAGRAGGPPPGGGAPWHLRNVLSDSVESSDDEFFDAREEMAEGKNAILIGMSQWNSNDLVEQIETMGK
1-70
LDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHVLLLVLHGGNIL
70-140
DTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVSHLNPYSHDEGCLSSS
140-210
QDHVPLAALPLLAISSPQYQDAVATVIERANQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAICYSA
210-280
GPSGDSPASSSRKGSISSTQDTPVAVEEDCSLASSKRLSKSNIDISSGLEDEEPKRPLPRKQSDSSTYDC
280-350
EAITQHHAFLSSIHSSVLKDESETPAAGGPQLPEVSLGRFDFDVSDFFLFGSPLGLVLAMRRTVLPGLDG
350-420
FQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEG
420-490
SSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPD
490-560
VLTAFPTVALPHLFHASYWESTDVVAFILRQVMRYESVNIKESARLDPAALSPANPREKWLRKRTQVKLR
560-630
NVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMAEPSSGRWVHLDTEITNSSGRITYN
630-700
VPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRH
700-770
WQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYG
770-840
STKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAALEASHRSRPKKNNSRMILRKGSFGL
840-910
HAQPEFLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWARGPPKFESVP
910-974
MAKAGRAGGPPPGGGAPWHLRNVLSDSVESSDDEFFDAREEMAEGKNAILIGMSQWNSNDLVEQIETMGKLDEHQGEGTAPCTSSILQEKQRELYRVSLRRQRFPAQGSIEIHEDSEEGCPQRSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVSHLNPYSHDEGCLSSSQDHVPLAALPLLAISSPQYQDAVATVIERANQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAICYSAGPSGDSPASSSRKGSISSTQDTPVAVEEDCSLASSKRLSKSNIDISSGLEDEEPKRPLPRKQSDSSTYDCEAITQHHAFLSSIHSSVLKDESETPAAGGPQLPEVSLGRFDFDVSDFFLFGSPLGLVLAMRRTVLPGLDGFQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVMRYESVNIKESARLDPAALSPANPREKWLRKRTQVKLRNVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMAEPSSGRWVHLDTEITNSSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYGSTKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAALEASHRSRPKKNNSRMILRKGSFGLHAQPEFLRKRNHLRRTMSVQQPDPPAANPKPERAQSQPESDKDHERPLPALSWARGPPKFESVP