You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RPE65
Retinoid isomerohydrolase

Protein Summary
Description
Critical isomerohydrolase in the retinoid cycle involved in regeneration of 11-cis-retinal, the chromophore of rod and cone opsins. Catalyzes the cleavage and isomerization of all-trans-retinyl fatty acid esters to 11-cis-retinol which is further oxidized by 11-cis retinol dehydrogenase to 11-cis-retinal for use as visual chromophore (PubMed:16116091). Essential for the production of 11-cis retinal for both rod and cone photoreceptors (PubMed:17848510). Also capable of catalyzing the isomerization of lutein to meso-zeaxanthin an eye-specific carotenoid (PubMed:28874556). The soluble form binds vitamin A (all-trans-retinol), making it available for LRAT processing to all-trans-retinyl ester. The membrane form, palmitoylated by LRAT, binds all-trans-retinyl esters, making them available for IMH (isomerohydrolase) processing to all-cis-retinol. The soluble form is regenerated by transferring its palmitoyl groups onto 11-cis-retinol, a reaction catalyzed by LRAT (By similarity). The protei ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262340
  • ENSP00000262340
  • ENSG00000116745

Symbol
  • p63
  • BCO3
  • LCA2
  • RP20
  • rd12
  • mRPE65
  • sRPE65
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.71
cell type or tissue
0.65
biological process
0.59
cell line
0.56
phenotype
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 470.28   (req: < 5)
Gene RIFs: 64   (req: <= 3)
Antibodies: 220   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 470.28   (req: >= 5)
Gene RIFs: 64   (req: > 3)
Antibodies: 220   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (83)
G alpha (i) signalling events (R-HSA-418594)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Reactome
The canonical retinoid cycle in rods (twilight vision)
Name
Explore in Pharos
Explore in Source
G alpha (i) signalling events
GPCR downstream signalling
Signal Transduction
Signaling by GPCR
The canonical retinoid cycle in rods (twilight vision)
Gene Ontology Terms (27)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
AgBase
Inferred from Sequence or structural Similarity (ISS)
AgBase
Inferred from Sequence or structural Similarity (ISS)
AgBase
Inferred from Sequence or structural Similarity (ISS)
AgBase
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (127)
1 – 10 of 127
ZMYM2
Tbio
Novelty: 0.02496059
p_int: 0.919499205
p_ni: 0.080500795
Score: 0.214
Data Source: BioPlex,STRINGDB
CCT6B
Tdark
Novelty: 0.35608309
p_int: 0.874090978
p_ni: 0.125909022
Score: 0.537
Data Source: BioPlex,STRINGDB
CCT3
Tbio
Novelty: 0.00555442
p_int: 0.791668018
p_ni: 0.208331982
Score: 0.268
Data Source: BioPlex,STRINGDB
RLBP1
Tbio
Novelty: 0.00661911
Score: 0.988
Data Source: STRINGDB
LRAT
Tbio
Family: Enzyme
Novelty: 0.02898976
Score: 0.988
Data Source: STRINGDB
RDH5
Tbio
Family: Enzyme
Novelty: 0.01533722
Score: 0.982
Data Source: STRINGDB
RDH10
Tbio
Family: Enzyme
Novelty: 0.03283214
Score: 0.955
Data Source: STRINGDB
RDH11
Tbio
Family: Enzyme
Novelty: 0.005283
Score: 0.953
Data Source: STRINGDB
DGAT1
Tclin
Family: Enzyme
Novelty: 0.0015819
Score: 0.94
Data Source: STRINGDB
AWAT2
Tbio
Family: Enzyme
Novelty: 0.016834
Score: 0.911
Data Source: STRINGDB
Publication Statistics
PubMed Score  470.28

PubMed score by year
PubTator Score  302.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKF
1-70
DFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVG
70-140
EDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIP
140-210
PLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFE
210-280
SNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENW
280-350
EEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQ
350-420
INYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVV
420-490
VSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS
490-533
MSIQVEHPAGGYKKLFETVEELSSPLTAHVTGRIPLWLTGSLLRCGPGLFEVGSEPFYHLFDGQALLHKFDFKEGHVTYHRRFIRTDAYVRAMTEKRIVITEFGTCAFPDPCKNIFSRFFSYFRGVEVTDNALVNVYPVGEDYYACTETNFITKINPETLETIKQVDLCNYVSVNGATAHPHIENDGTVYNIGNCFGKNFSIAYNIVKIPPLQADKEDPISKSEIVVQFPCSDRFKPSYVHSFGLTPNYIVFVETPVKINLFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFNLFHHINTYEDNGFLIVDLCCWKGFEFVYNYLYLANLRENWEEVKKNARKAPQPEVRRYVLPLNIDKADTGKNLVTLPNTTATAILCSDETIWLEPEVLFSGPRQAFEFPQINYQKYCGKPYTYAYGLGLNHFVPDRLCKLNVKTKETWVWQEPDSYPSEPIFVSHPDALEEDDGVVLSVVVSPGAGQKPAYLLILNAKDLSEVARAEVEINIPVTFHGLFKKS