You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
AP5M1
AP-5 complex subunit mu-1

Protein Summary
Description
As part of AP-5, a probable fifth adaptor protein complex it may be involved in endosomal transport. According to PubMed:18395520, it may play a role in cell death.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261558
  • ENSP00000261558
  • ENSG00000053770

Symbol
  • C14orf108
  • MUDENG
  • Mu5
  • MuD
  • MUDENG
  • C14orf108
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.87
transcription factor binding site profile
0.76
kinase perturbation
0.71
cellular component
0.69
transcription factor perturbation
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.85   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 54   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 58.85   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 54   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (9)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (65)
1 – 10 of 65
AP5B1
Tdark
Novelty: 0.00232633
p_int: 0.999992576
p_ni: 0.000007422
p_wrong: 1e-9
Score: 0.989
Data Source: BioPlex,STRINGDB
DCAF4
Tdark
Novelty: 0.32846715
p_int: 0.999770364
p_ni: 0.000229636
Score: 0.219
Data Source: BioPlex,STRINGDB
SPG11
Tbio
Novelty: 0.00834446
p_int: 0.998664462
p_ni: 0.001335346
p_wrong: 1.92e-7
Score: 0.842
Data Source: BioPlex,STRINGDB
AP5S1
Tdark
Score: 0.989
Data Source: STRINGDB
AP4M1
Tbio
Novelty: 0.0041214
Score: 0.983
Data Source: STRINGDB
AP5Z1
Tdark
Family: TF
Novelty: 0.2536399
Score: 0.982
Data Source: STRINGDB
AP4B1
Tbio
Novelty: 0.1488148
Score: 0.944
Data Source: STRINGDB
AP4E1
Tdark
Novelty: 0.2006689
Score: 0.943
Data Source: STRINGDB
AP1G2
Tbio
Novelty: 0.19895784
Score: 0.943
Data Source: STRINGDB
AP1S1
Tbio
Novelty: 0.02404649
Score: 0.93
Data Source: STRINGDB
Publication Statistics
PubMed Score  58.85

PubMed score by year
PubTator Score  18.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQRAVWLISHEPGTPLCGTVRFSRRYPTVEKRARVFNGASYVPVPEDGPFLKALLFELRLLDDDKDFVE
1-70
SRDSCSRINKTSIYGLLIGGEELWPVVAFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGIQD
70-140
FLYSGQKNDSELNTKLSQLPDLLLQACPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVS
140-210
ISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPTNGSPLQDILVHPCVTSLDSAIL
210-280
TSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITINLKLHESVKNN
280-350
FEFCEAHIPFYNRGPITHLEYKTSFGQLEVFREKSLLIWIIGQKFPKSMEISLSGTVTFGAKSHEKQPFD
350-420
PICTGETAYLKLHFRILDYTLTGCYADQHSVQVFASGKPKISAHRKLISSDYYIWNSKAPAPVTYGSLLL
420-490
MAQRAVWLISHEPGTPLCGTVRFSRRYPTVEKRARVFNGASYVPVPEDGPFLKALLFELRLLDDDKDFVESRDSCSRINKTSIYGLLIGGEELWPVVAFLKNDMIYACVPLVEQTLSPRPPLISVSGVSQGFEFLFGIQDFLYSGQKNDSELNTKLSQLPDLLLQACPFGTLLDANLQNSLDNTNFASVTQPQKQPAWKTGTYKGKPQVSISITEKVKSMQYDKQGIADTWQVVGTVTCKCDLEGIMPNVTISLSLPTNGSPLQDILVHPCVTSLDSAILTSSSIDAMDDSAFSGPYKFPFTPPLESFNLCFYTSQVPVPPILGFYQMKEEEVQLRITINLKLHESVKNNFEFCEAHIPFYNRGPITHLEYKTSFGQLEVFREKSLLIWIIGQKFPKSMEISLSGTVTFGAKSHEKQPFDPICTGETAYLKLHFRILDYTLTGCYADQHSVQVFASGKPKISAHRKLISSDYYIWNSKAPAPVTYGSLLL