You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
XYLT1
Xylosyltransferase 1

Protein Summary
Description
Catalyzes the first step in the biosynthesis of chondroitin sulfate and dermatan sulfate proteoglycans, such as DCN. Transfers D-xylose from UDP-D-xylose to specific serine residues of the core protein (PubMed:15461586, PubMed:17189265, PubMed:24581741, PubMed:23982343). Required for normal embryonic and postnatal skeleton development, especially of the long bones (PubMed:24581741, PubMed:23982343). Required for normal maturation of chondrocytes during bone development, and normal onset of ossification (By similarity). This locus encodes a xylosyltransferase enzyme. The encoded protein catalyzes transfer of UDP-xylose to serine residues of an acceptor protein substrate. This transfer reaction is necessary for biosynthesis of glycosaminoglycan chains. Mutations in this gene have been associated with increased severity of pseudoxanthoma elasticum.[provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261381
  • ENSP00000261381
  • ENSG00000103489
  • ENST00000644858
  • ENSP00000495604
  • ENSG00000285395

Symbol
  • XT1
  • XT1
  • XTI
  • XT-I
  • DBQD2
  • XYLTI
  • PXYLT1
  • xylT-I
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
phenotype
0.65
disease
0.63
interacting protein
0.61
tissue sample
0.61
trait
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 144.14   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 102   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 144.14   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 102   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
A tetrasaccharide linker sequence is required for GAG synthesis (R-HSA-1971475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
A tetrasaccharide linker sequence is required for GAG synthesis
Reactome
Chondroitin sulfate/dermatan sulfate metabolism
Reactome
Glycosaminoglycan metabolism
Reactome
Heparan sulfate/heparin (HS-GAG) metabolism
Reactome
Metabolism
Name
Explore in Pharos
Explore in Source
A tetrasaccharide linker sequence is required for GAG synthesis
Chondroitin sulfate/dermatan sulfate metabolism
Glycosaminoglycan metabolism
Heparan sulfate/heparin (HS-GAG) metabolism
Metabolism
Protein-Protein Interactions (67)
1 – 10 of 67
ADH1C
Tclin
Family: Enzyme
Novelty: 0.00612618
p_int: 0.993270764
p_wrong: 0.006729236
Score: 0.699
Data Source: BioPlex,STRINGDB
B4GALT7
Tbio
Family: Enzyme
Novelty: 0.02379917
Score: 0.982
Data Source: STRINGDB
DCN
Tbio
Novelty: 0.00087842
Score: 0.941
Data Source: STRINGDB
HSPG2
Tbio
Family: Enzyme
Novelty: 0.0008386
Score: 0.935
Data Source: STRINGDB
NCAN
Tbio
Novelty: 0.0061551
Score: 0.934
Data Source: STRINGDB
BCAN
Tbio
Novelty: 0.00960788
Score: 0.934
Data Source: STRINGDB
SDC2
Tbio
Novelty: 0.00780417
Score: 0.933
Data Source: STRINGDB
VCAN
Tbio
Novelty: 0.00132314
Score: 0.93
Data Source: STRINGDB
BGN
Tbio
Novelty: 0.00181025
Score: 0.929
Data Source: STRINGDB
GPC2
Tbio
Novelty: 0.04351809
Score: 0.926
Data Source: STRINGDB
Publication Statistics
PubMed Score  144.14

PubMed score by year
PubTator Score  60.43

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDL
1-70
PAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARALDPHPSPLITLETQDGYFSH
70-140
RPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPSRQKELLKRKLEQQEKGKGHTFPG
140-210
KGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEI
210-280
GETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIY
280-350
HKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFI
350-420
NLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVD
420-490
GGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLG
490-560
CKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSY
560-630
WENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLI
630-700
KHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQ
700-770
KWGKGPNVTVTVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVA
770-840
PLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLV
840-910
GGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR
910-959
MVAAPCARRLARRSHSALLAALTVLLLQTLVVWNFSSLDSGAGERRGGAAVGGGEQPPPAPAPRRERRDLPAEPAAARGGGGGGGGGGGGRGPQARARGGGPGEPRGQQPASRGALPARALDPHPSPLITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPELAKKPPSRQKELLKRKLEQQEKGKGHTFPGKGPGEVLPPGDRAAANSSHGKDVSRPPHARKTGGSSPETKYDQPPKCDISGKEAISALSRAKSKHCRQEIGETYCRHKLGLLMPEKVTRFCPLEGKANKNVQWDEDSVEYMPANPVRIAFVLVVHGRASRQLQRMFKAIYHKDHFYYIHVDKRSNYLHRQVLQVSRQYSNVRVTPWRMATIWGGASLLSTYLQSMRDLLEMTDWPWDFFINLSAADYPIRTNDQLVAFLSRYRDMNFLKSHGRDNARFIRKQGLDRLFLECDAHMWRLGDRRIPEGIAVDGGSDWFLLNRRFVEYVTFSTDDLVTKMKQFYSYTLLPAESFFHTVLENSPHCDTMVDNNLRITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKFEAVVNQEIIGQLDYYLYGNYPAGTPGLRSYWENVYDEPDGIHSLSDVTLTLYHSFARLGLRRAETSLHTDGENSCRYYPMGHPASVHLYFLADRFQGFLIKHHATNLAVSKLETLETWVMPKKVFKIASPPSDFGRLQFSEVGTDWDAKERLFRNFGGLLGPMDEPVGMQKWGKGPNVTVTVIWVDPVNVIAATYDILIESTAEFTHYKPPLNLPLRPGVWTVKILHHWVPVAETKFLVAPLTFSNRQPIKPEEALKLHNGPLRNAYMEQSFQSLNPVLSLPINPAQVEQARRNAASTGTALEGWLDSLVGGMWTAMDICATGPTACPVMQTCSQTAWSSFSPDPKSELGAVKPDGRLR