You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
USP2
Ubiquitin carboxyl-terminal hydrolase 2

Protein Summary
Description
Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1 (PubMed:17290220, PubMed:19917254, PubMed:19838211). Isoform 1 and isoform 4 possess both ubiquitin-specific peptidase and isopeptidase activities (By similarity). Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus indirectly promotes p53/TP53 degradation and limits p53 activity (PubMed:17290220, PubMed:19838211). Has no deubiquitinase activity against p53/TP53 (PubMed:17290220). Prevents MDM2-mediated degradation of MDM4 (PubMed:17290220). Plays a role in the G1/S cell-cycle progression in normal and cancer cells (PubMed:19917254). Regulates the circadian clock by modulating its intrinsic circadian rhythm and its capacity to respond to external cues (By similarity). Associates with clock proteins and deubiquitinates core clock component PER1 but does not affect its overall stability (By similarity). Regulates the nucleocytoplasmic shuttling and nuclear reten ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260187
  • ENSP00000260187
  • ENSG00000036672
  • ENST00000455332
  • ENSP00000407842
  • ENST00000525735
  • ENSP00000436952

Symbol
  • UBP41
  • USP9
  • UBP41
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.88
biological process
0.86
histone modification site profile
0.84
transcription factor
0.74
molecular function
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 96.12   (req: < 5)
Gene RIFs: 35   (req: <= 3)
Antibodies: 393   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 96.12   (req: >= 5)
Gene RIFs: 35   (req: > 3)
Antibodies: 393   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (124)
Death Receptor Signalling (R-HSA-73887)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Death Receptor Signalling
Reactome
Deubiquitination
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism of proteins
Name
Explore in Pharos
Explore in Source
Death Receptor Signalling
Deubiquitination
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism of proteins
Gene Ontology Terms (23)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
FlyBase
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (118)
1 – 10 of 118
MID1IP1
Tbio
Novelty: 0.16023307
p_int: 0.980573704
p_ni: 4.6e-8
p_wrong: 0.01942625
Data Source: BioPlex
UBC
Tbio
Novelty: 0.00161137
Score: 0.995
Data Source: STRINGDB
UBB
Tbio
Novelty: 0.00895161
Score: 0.994
Data Source: STRINGDB
RPS27A
Tbio
Novelty: 0.01148413
Score: 0.993
Data Source: STRINGDB
UBA52
Tbio
Novelty: 0.01006012
Score: 0.99
Data Source: STRINGDB
MDM4
Tchem
Novelty: 0.00416179
Score: 0.956
Data Source: Reactome,STRINGDB
MDM2
Tchem
Family: Enzyme
Novelty: 0.00036068
Score: 0.951
Data Source: Reactome,STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
Score: 0.947
Data Source: STRINGDB
TRAF2
Tbio
Novelty: 0.01051586
Score: 0.946
Data Source: STRINGDB
RIPK1
Tchem
Family: Kinase
Novelty: 0.00302762
Score: 0.944
Data Source: STRINGDB
Publication Statistics
PubMed Score  96.12

PubMed score by year
PubTator Score  69.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSS
1-70
LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKL
70-140
DSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQ
140-210
VPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNS
210-280
ILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRF
280-350
VGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK
350-420
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFS
420-490
IQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTA
490-560
YCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM
560-605
MSQLSSTLKRYTESARYTDAHYAKSGYGAYTPSSYGANLAASLLEKEKLGFKPVPTSSFLTRPRTYGPSSLLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNNCLSYLPINAYDQGVTLTQKLDSQSDLARDFSSLRTSDSYRIDPRNLGRSPMLARTRKELCTLQGLYQTASCPEYLVDYLENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCRGRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPPSRM