You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PSORS1C1
Psoriasis susceptibility 1 candidate gene 1 protein

Protein Summary
Description
This gene is one of several genes thought to confer susceptibility to psoriasis and systemic sclerosis, located on chromosome 6 near the major histocompatibility complex (MHC) class I region. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000259881
  • ENSP00000259881
  • ENSG00000204540
  • ENST00000420214
  • ENSP00000396568
  • ENSG00000233439
  • ENST00000433334
  • ENSP00000391443
  • ENSG00000233734
  • ENST00000441092
  • ENSP00000398278
  • ENSG00000231094
  • ENST00000448455
  • ENSP00000389875
  • ENSG00000235487

Symbol
  • C6orf16
  • SEEK1
  • SEEK1
  • C6orf16
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
1
phenotype
0.82
tissue sample
0.7
disease
0.64
gene perturbation
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.85   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 88   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.85   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 88   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (68)
1 – 10 of 68
CDSN
Tbio
Novelty: 0.0147621
Score: 0.839
Data Source: STRINGDB
CCHCR1
Tbio
Novelty: 0.01110278
Score: 0.669
Data Source: STRINGDB
TCF19
Tbio
Family: Epigenetic
Novelty: 0.12976738
Score: 0.668
Data Source: STRINGDB
PSORS1C2
Tbio
Novelty: 0.08354861
Score: 0.581
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.563
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.563
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.563
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.563
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.563
Data Source: STRINGDB
HLA-C
Tbio
Novelty: 0.01022087
Score: 0.563
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.85

PubMed score by year
PubTator Score  16.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFH
1-70
LAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSP
70-140
PSHSPFGLSSLI
140-152
MTCTDQKSHSQRALGTQTPALQGPQLLNTDPSSEETRPPHVNPDRLCHMEPANHFWHAGDLQAMISKEFHLAATQDDCRKGRTQEDILVPSSHPELFASVLPMAPEEAARLQQPQPLPPPSGIHLSASRTLAPTLLYSSPPSHSPFGLSSLI