You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
GABBR2
Gamma-aminobutyric acid type B receptor subunit 2

Protein Summary
Description
Component of a heterodimeric G-protein coupled receptor for GABA, formed by GABBR1 and GABBR2 (PubMed:9872316, PubMed:9872744, PubMed:15617512, PubMed:18165688, PubMed:22660477, PubMed:24305054). Within the heterodimeric GABA receptor, only GABBR1 seems to bind agonists, while GABBR2 mediates coupling to G proteins (PubMed:18165688). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase (PubMed:10075644, PubMed:10773016, PubMed:24305054). Signaling inhibits adenylate cyclase, stimulates phospholipase A2, activates potassium channels, inactivates voltage-dependent calcium-channels and modulates inositol phospholipid hydrolysis (PubMed:10075644, PubMed:9872744, PubMed:10906333, PubMed:10773016). Plays a critical role in the fine-tuning of inhibitory synaptic transmission (PubMed:9872744, PubMed:22660477). Pre-synaptic GABA receptor inhibits neu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000259455
  • ENSP00000259455
  • ENSG00000136928

Symbol
  • GPR51
  • GPRC3B
  • HG20
  • GPR51
  • EIEE59
  • GPRC3B
  • NDPLHS
  • GABABR2
  • HRIHFB2099
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
0.93
protein domain
0.92
small molecule perturbation
0.71
PubMedID
0.69
phenotype
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 90.75   (req: < 5)
Gene RIFs: 30   (req: <= 3)
Antibodies: 515   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 90.75   (req: >= 5)
Gene RIFs: 30   (req: > 3)
Antibodies: 515   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Active Ligands (1)
1 – 1 of 1
CGP7930
chemical structure image
Protein Data Bank (12)
1 – 5 of 12
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Activation of G protein gated Potassium channels (R-HSA-1296041)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 17
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of G protein gated Potassium channels
Reactome
Activation of GABAB receptors
Reactome
Class C/3 (Metabotropic glutamate/pheromone receptors)
Reactome
G alpha (i) signalling events
Reactome
G protein gated Potassium channels
Name
Explore in Pharos
Explore in Source
Activation of G protein gated Potassium channels
Activation of GABAB receptors
Class C/3 (Metabotropic glutamate/pheromone receptors)
G alpha (i) signalling events
G protein gated Potassium channels
Protein-Protein Interactions (321)
1 – 10 of 321
GABBR1
Tclin
Family: GPCR
Novelty: 0.00136121
Score: 0.989
Data Source: Reactome,STRINGDB
HTR1A
Tclin
Family: GPCR
Novelty: 0.00019966
Score: 0.959
Data Source: STRINGDB
KCNJ9
Tbio
Family: IC
Novelty: 0.03269124
Score: 0.955
Data Source: Reactome,STRINGDB
HTR5A
Tchem
Family: GPCR
Novelty: 0.01826019
Score: 0.95
Data Source: STRINGDB
KCNJ3
Tchem
Family: IC
Novelty: 0.00450374
Score: 0.949
Data Source: Reactome,STRINGDB
KCNJ6
Tchem
Family: IC
Novelty: 0.00501806
Score: 0.948
Data Source: Reactome,STRINGDB
TAS2R38
Tbio
Family: GPCR
Novelty: 0.00547147
Score: 0.944
Data Source: STRINGDB
DRD2
Tclin
Family: GPCR
Novelty: 0.00028344
Score: 0.942
Data Source: STRINGDB
GRM3
Tchem
Family: GPCR
Novelty: 0.00438401
Score: 0.941
Data Source: STRINGDB
NPBWR1
Tchem
Family: GPCR
Novelty: 0.02260656
Score: 0.934
Data Source: STRINGDB
Publication Statistics
PubMed Score  90.75

PubMed score by year
PubTator Score  149.74

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMGLMPLTKEVAK
1-70
GSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTS
70-140
IIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSE
140-210
VRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWI
210-280
IPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVG
280-350
PSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNG
350-420
ERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTI
420-490
LGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWIL
490-560
TVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSM
560-630
EPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVG
630-700
IMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKED
700-770
SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
770-840
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGV
840-910
DASCVSPCVSPTASPRHRHVPPSFRVMVSGL
910-941
MASPRSSGQPGPPPPPPPPPARLLLLLLLPLLLPLAPGAWGWARGAPRPPPSSPPLSIMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRPYFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVFRNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNLGNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTCKDPIEDINSPEHIQRRLSLQLPILHHAYLPSIGGVDASCVSPCVSPTASPRHRHVPPSFRVMVSGL