You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NPL
N-acetylneuraminate lyase

Protein Classes
Protein Summary
Description
Catalyzes the cleavage of N-acetylneuraminic acid (sialic acid) to form pyruvate and N-acetylmannosamine via a Schiff base intermediate. It prevents sialic acids from being recycled and returning to the cell surface. Involved in the N-glycolylneuraminic acid (Neu5Gc) degradation pathway. Although human is not able to catalyze formation of Neu5Gc due to the inactive CMAHP enzyme, Neu5Gc is present in food and must be degraded (By similarity). This gene encodes a member of the N-acetylneuraminate lyase sub-family of (beta/alpha)(8)-barrel enzymes. N-acetylneuraminate lyases regulate cellular concentrations of N-acetyl-neuraminic acid (sialic acid) by mediating the reversible conversion of sialic acid into N-acetylmannosamine and pyruvate. A pseudogene of this gene is located on the short arm of chromosome 2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000258317
  • ENSP00000258317
  • ENSG00000135838
  • ENST00000367552
  • ENSP00000356523
  • ENST00000367553
  • ENSP00000356524
  • ENST00000367554
  • ENSP00000356525
  • ENST00000367555
  • ENSP00000356526

Symbol
  • C1orf13
  • NAL
  • C112
  • NPL1
  • C1orf13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
histone modification site profile
0.79
gene perturbation
0.72
PubMedID
0.71
microRNA
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1288.91   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 115   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1288.91   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 115   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (10)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Sialic acid metabolism
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Metabolism of proteins
Post-translational protein modification
Sialic acid metabolism
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Protein-Protein Interactions (106)
1 – 10 of 106
QPRT
Tbio
Family: Enzyme
Novelty: 0.00969466
p_int: 0.99996304
p_ni: 0.000035757
p_wrong: 0.000001203
Score: 0.432
Data Source: BioPlex,STRINGDB
RENBP
Tbio
Family: Enzyme
Novelty: 0.02774701
Score: 0.971
Data Source: STRINGDB
NANS
Tbio
Family: Enzyme
Novelty: 0.01128195
Score: 0.965
Data Source: STRINGDB
GNE
Tbio
Family: Enzyme
Novelty: 0.00329705
Score: 0.957
Data Source: STRINGDB
ENOSF1
Tbio
Family: Enzyme
Novelty: 0.09126106
Score: 0.844
Data Source: STRINGDB
ACD
Tbio
Novelty: 0.00356212
Score: 0.788
Data Source: STRINGDB
ST8SIA5
Tdark
Family: Enzyme
Novelty: 0.06096194
Score: 0.774
Data Source: STRINGDB
CMAS
Tbio
Family: Enzyme
Novelty: 0.00224205
Score: 0.748
Data Source: STRINGDB
GNRH1
Tbio
Novelty: 0.00024998
Score: 0.737
Data Source: STRINGDB
FUOM
Tbio
Family: Enzyme
Novelty: 0.1
Score: 0.696
Data Source: STRINGDB
Publication Statistics
PubMed Score  1288.91

PubMed score by year
PubTator Score  146.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEW
1-70
VTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPF
70-140
YYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVM
140-210
GATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGP
210-280
PRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS
280-320
MAFPKKKLQGLVAATITPMTENGEINFSVIGQYVDYLVKEQGVKNIFVNGTTGEGLSLSVSERRQVAEEWVTKGKDKLDQVIIHVGALSLKESQELAQHAAEIGADGIAVIAPFFLKPWTKDILINFLKEVAAAAPALPFYYYHIPALTGVKIRAEELLDGILDKIPTFQGLKFSDTDLLDFGQCVDQNRQQQFAFLFGVDEQLLSALVMGATGAVGSTYNYLGKKTNQMLEAFEQKDFSLALNYQFCIQRFINFVVKLGFGVSQTKAIMTLVSGIPMGPPRLPLQKASREFTDSAEAKLKSLDFLSFTDLKDGNLEAGS